KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3396
Entry
XBJ1_3396         CDS       T01186                                 

Definition
(GenBank) conserved hypothetical protein; putative exported protein
Organism
xbo  Xenorhabdus bovienii SS-2004
SSDB
Motif
Pfam: DUF3438
Other DBs
NCBI-ProteinID: CBJ82514
UniProt: D3V4D5
Position
3306716..3307552
AA seq 278 aa
MKRYPSCSSACFWLGLVSLVLFSLGAKADELMKWERIPLSIALKVGQERIIFADRNVRVG
LSPSLSDKLRVQSAGGAIYLKASQSFPSTRLQLQDSENGEIILLDITATKTGPTEPVRIL
YPDEKNSVPKEGAPHQRKSAPLAPAPVILTRYAAQQLYAPLRTVEPVTGIHPVSLHLPAA
ITTVYPSEPIAVSPLAGWGMQNYTVVALKLRNTAKRNITLDPRALQGQFVAATFQHRWLG
EAGTPEDTTVLYLVTRGQPDNAFIPEPVTVKPGGRHAG
NT seq 837 nt   +upstreamnt  +downstreamnt
atgaaaagatatccatcttgctcttctgcctgtttttggctgggattggtcagcctcgtg
ctgttcagcctcggtgcaaaggctgatgaactgatgaaatgggaacgcattccgttatcc
attgccctcaaggtaggtcaggagcggattattttcgcagacagaaatgtccgtgttggt
ttgtctccgtcactcagcgataaactgcgggtgcagagcgcagggggagccatttacctg
aaagccagccaatcttttccgtctacccgtctgcaattgcaggacagtgaaaacggcgaa
attatcttactggatattaccgccaccaaaacggggccaacggaacccgtccgcattctt
tatccggatgaaaaaaattctgtaccaaaagagggggcaccgcatcagagaaaatcagca
cctttggctcccgcgcctgtgatattaacccgctatgccgctcagcagctttatgccccg
ctgcgtaccgtcgagccggttacggggatccacccggtcagtctgcatttacccgccgcc
atcaccaccgtctatccgtcggaaccgattgcggtttccccgctggccggctggggcatg
caaaattacacggtggtagccctgaaactgcgtaatacggccaaacgcaacattacgctc
gacccacgagccttgcaggggcaatttgtcgcagcaacgtttcagcatcgttggctgggt
gaagcagggacaccggaagataccacagtgctgtatcttgtgacccgaggacagccggat
aatgcttttatccctgagccggtaacagtgaaaccgggaggccgtcatgcaggttaa

DBGET integrated database retrieval system