KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3397
Entry
XBJ1_3397         CDS       T01186                                 
Name
(GenBank) putative exported protein
Organism
xbo  Xenorhabdus bovienii SS-2004
SSDB
Motif
Pfam: TrbI ZapB Mod_r APG6_N
Other DBs
NCBI-ProteinID: CBJ82515
UniProt: D3V4D6
Position
3307542..3308972
AA seq 476 aa
MQVKSNSLVKILVPMVLMVGGFIGIKSCSSTDTTAPDTPPNNVLATLSPEELQALGVGGD
TPEDTLRTLVGTLNKVRSEQQRLGQQNADILKENDQLKNQRQDVAGQIDAAVAAIRQDDE
QRRRELQDEQQGLLAQIDLLTERLNSAPLSAPDSPIPLGSGSIPYSANAGTGQNELIWIT
PADEKPADIQTPGSGKATAQFPTSFLSEQSAAGQSKPQSPSLQNPSKEENEQPVYTLPEN
ATLVGSQAMTALLGRVPVNGAVTDPYPFKILIGKDNLTANGIELPEVEGAVVSGSASGDW
TLSCVRGQVNSITVVFQDGTVRTLPGSGQNNNTSANGIGWLSDENGIPCISGERKSNAAT
YLPTLFALSAMHSAGDALSESQRTAQTSGTGGITTALTGNAGQAALGKAMSGGMNDMSEW
LRQRYSQTFDAIYVPPGARVVVHITQRLAIDYETKGRKVRYGVREAAQRDNQEALD
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgcaggttaaatccaacagtctggtgaaaatcctggtgccgatggtgctgatggtcggc
gggtttatcggcatcaaaagttgcagctcaaccgacactaccgcgcccgatacgccaccc
aacaatgtcctggccacattgtcaccggaggagttacaggcgctgggtgtcggcggtgat
acgccggaagataccttgcgtacgctggtgggaacactcaataaagtgcggtcagagcag
caacgcttaggtcagcagaatgccgatatcctgaaagaaaatgaccagttaaaaaatcag
cgtcaggatgtcgccggtcagatagacgcggcggtggcagctatccggcaggacgatgaa
cagcgccggcgtgaattacaggatgaacagcagggattgctggcacagattgatttactg
acggaacgcttaaattcagcgcctttgtctgcgccggacagtccgataccacttgggtcg
ggaagtattccgtattctgccaatgcaggcacagggcagaatgaacttatctggataaca
ccggccgatgaaaagcccgcagacatacaaacccccggcagtggaaaagccacggcgcag
ttcccgacctcatttttaagtgaacagtcagccgccgggcaaagtaagccccaaagccca
tcgcttcaaaacccatcaaaggaagaaaatgaacagccggtctataccctgcctgaaaat
gccacgttagtgggcagtcaggccatgaccgcgttattaggccgtgttcccgtcaatggt
gcagtgactgacccttatccattcaaaatccttatcggcaaagacaacctgacggccaac
ggcattgaactgccggaggtggaaggggcggtggtgtccggctcagccagtggcgactgg
acactctcctgcgtgcgcggtcaggtcaattccatcacggttgtttttcaggatggcacg
gtgcgtaccctgccgggcagcgggcaaaacaacaataccagcgcgaacggcatcggctgg
ctgtctgatgaaaacggcattccctgtatcagcggtgagcgcaaatccaacgccgccacc
tatctgccgaccctgtttgcgctctcggccatgcattcggccggcgatgccctgagtgaa
agtcagcgtactgcccagaccagcggcacaggcggtatcaccaccgcgttaacgggcaat
gccggacaggccgcattgggcaaagcgatgtcaggtggcatgaatgacatgagcgaatgg
ctcagacagcgctacagccagacgtttgatgcgatttacgtcccgcccggtgcccgtgtt
gtggtgcatatcacacaacgcctggcgattgattacgaaacgaaaggacgtaaggtgcgc
tacggcgtgcgtgaggccgcccaacgtgacaatcaggaagcattagattaa

DBGET integrated database retrieval system