KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3399
Entry
XBJ1_3399         CDS       T01186                                 

Definition
(GenBank) conserved hypothetical protein; putative exported protein
Organism
xbo  Xenorhabdus bovienii SS-2004
SSDB
Other DBs
NCBI-ProteinID: CBJ82517
UniProt: D3V4D8
Position
3309316..3309717
AA seq 133 aa
MWKIKYYGIVCLAGLLAGCATSKETLLPAGEQTVLAMWQGNKAGHATASARETLRRSLTV
SERLRALEEPYHYSRSAAQEISQQFPRLPNPDMVMYVFPHLVAGNTPIPGYSTVFPFYSQ
VQYALSGERTEAL
NT seq 402 nt   +upstreamnt  +downstreamnt
atgtggaaaataaaatattatgggatagtgtgtctggcggggttactggccggctgtgct
acctcgaaagagaccttattacctgccggagagcaaacggtgctggcaatgtggcagggg
aataaggccggtcatgccaccgcatcggcaagggaaacattgcgccgttctttaactgta
tctgaacggctcagggcactggaagaaccctatcattacagccgttcagccgcgcaggaa
atcagccaacagtttccccgcttacccaatcccgatatggtgatgtatgtttttccgcat
ctggtcgccggcaatacgccgataccgggctacagcacggtgttcccattttacagccaa
gtacaatatgccctgtcgggtgaacgcacggaggcactgtaa

DBGET integrated database retrieval system