KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3400
Entry
XBJ1_3400         CDS       T01186                                 
Name
(GenBank) conserved hypothetical protein
Organism
xbo  Xenorhabdus bovienii SS-2004
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG DUF87 AAA_10 FtsK_SpoIIIE HerA_C AAA_29 AAA_22
Other DBs
NCBI-ProteinID: CBJ82518
UniProt: D3V4D9
Position
3309717..3312482
AA seq 921 aa
MEKPKALNRPGKLREADETTIYHANPSIIDYLPWVEYLEDGQCLLLDDGISVGAVYQIES
IATEGRPAERLTEIRDQLEDAIQDSLEEDDISPWVVQFFCQDDDDPADYLNTLRGYVKPW
AQGTLFTDAFLTESEHHLNSIARPDGIFQDSLITGQPWRGQQRQTRMVVYRWLPDGRRSH
VSNPALSAVAALNQVCERLVSSLASAGVIARRQHGGQIHSWLLRHFNPAPDWGMAKADFY
HTVSYGTTTLSDLPVNNDFAESLWFTPPVSDPDAGVWWFDGLPHKAVLVERLRRPPEPGT
LTGEVKRGDNINTLMDMMPAGTVVSLTIVAQAQDRLEEDFTRLTKNAVGENTESLRVRQD
VQEVKELLGRRHKLYRSALAFLVRGRDLDDINHRVHQLSSTLLTAGLQPVRPEFSVSPLN
AWLRALPMCFNPQKDKKHGYSRLTWVQHLAGLLPVTGRSTGTGHPGFSFFNRGGAPLTFD
PMNKQDRTQNAHLLLFGPTGAGKSATLCASLIQLMAVHRPRLFIVEAGNSFGLLADYYES
LGLTVNKIGIRPGCGVSLALFADAHQLLKLSPKQLRINEADIPDTDEQQEEEGDEQRDIL
GEMEIAARLMITGGEKREEERLTRSDRGLIREAIMMAAQTSFNEKRQMVASDLQNALYAI
ARNHRQDEHGQPLITAHRRARADEMASAMSMFTQGFEGELFNRPGTSWPEVDVTLIDLGT
LARENYSAQMALAMVSLINKVNNLAERDQYQDRELQLVIDEGHITTTNPLLSPYMTKVVK
MWRKLGTWLWLATQNLADYPDTAEKMLNMAEWWLCLTMPPDEVEQIARFKKLTEEEKAVL
LSASKLPRCYTEGVVLAKKIEALFRVVPPSLYLALGMTEKEEKAERRALMREHQCSELEA
AFLVARKMDIARGLKVDSGSV
NT seq 2766 nt   +upstreamnt  +downstreamnt
atggaaaaacccaaggcactgaaccgtcccggtaaattgcgtgaggcggatgaaactact
atttaccatgcaaacccttccatcatcgattacctgccctgggtggaatatctggaagac
gggcaatgtttattgttggatgacgggatttccgtcggcgcggtctatcagattgaatcc
attgccaccgaaggccgtcccgctgagcggttgactgaaatccgggatcaactggaagat
gcgatccaggacagtctggaagaagatgatatttcgccgtgggtggtgcagtttttttgt
caggatgacgatgatcctgctgactatctcaacaccttgcggggctatgtgaaaccctgg
gcacagggaacactgtttactgacgcctttctgacggaatcagagcatcacctgaacagc
attgcccggcctgacgggatatttcaggacagcttaatcaccgggcaaccgtggcggggc
cagcaacgccagacccgtatggtggtttatcggtggctgcctgacgggcgcagatcccat
gttagcaatccggccttatcagcggtggctgcgctcaatcaggtctgcgaacgtctggtc
tcgtcactggcttctgccggtgtgattgcccgccgacaacatggcggccagatccacagt
tggctgttacgtcactttaatccggcaccggattgggggatggcaaaagccgatttttac
catacggtgagttatggtaccaccaccctatcggatctccccgtcaacaatgactttgct
gaaagcctgtggtttaccccgccggtgtctgatcccgacgcgggcgtctggtggtttgac
gggttaccgcataaagcggtgctggttgagcgtctgcgccgtccgccggaaccgggaaca
ctgacaggcgaagtgaaacggggcgacaatatcaatactctgatggatatgatgccggca
gggacggtagtttcgctgaccattgtggcgcaggcacaggacaggctggaagaggatttt
acccggctgacgaaaaatgcggtgggagaaaatactgaatcgctgcgcgtccggcaggat
gtgcaggaagtgaaagaacttctggggcggcggcataaattgtaccgcagtgcgctggcc
tttctggtgcggggcagggatctggatgatataaaccaccgggtacatcaattatcctcc
accctgctgacagccggattacagcccgtccggccggaattcagtgtgtcaccgctgaat
gcctggttacgggcactgccgatgtgctttaacccgcagaaagacaaaaaacacgggtac
agccgcctgacctgggtacagcatctggccgggttattgccggtgacaggtcgttcgacc
ggcaccgggcatccggggttcagtttctttaaccggggcggggcaccgctgacctttgat
ccgatgaacaaacaggatcgcacccagaatgcccatttactgctgtttggtccgaccggc
gcggggaaatccgccaccctgtgcgcctcgctcatccagttaatggcagtacatcggccg
cgtctgtttattgtggaggcgggaaacagttttggcttgctggccgattactatgaaagt
ctggggctgacggtcaataaaatcggtatcagaccgggttgtggcgtcagtctggcgctg
tttgccgatgcccatcaactgttgaaactgagtcccaagcaattgcgcattaatgaagcc
gatatccccgataccgatgaacaacaggaagaggagggggatgaacagcgcgatatcctg
ggcgaaatggaaattgccgcccgactgatgatcaccggtggtgagaaaagagaagaagaa
cgcctgacccgctctgatcgcggtttaattcgtgaggccattatgatggcggcgcagacc
agctttaacgagaaacgccagatggtggcctcggatttacagaatgccctttatgccatc
gcccgtaatcaccggcaggatgaacacggccagccgttaatcaccgctcaccgacgggca
cgggcagatgaaatggccagcgccatgtcaatgtttacacaaggctttgagggtgaactg
tttaaccgccccggtacgtcgtggccggaagtggatgtcaccctgattgatttgggcaca
ctggcacgggagaactactcggcgcaaatggcactggcgatggtgtcactcatcaacaaa
gtcaataacctggctgaacgggatcaatatcaggatcgcgaactgcaactggtgattgat
gaaggacatatcaccaccaccaacccgctgttatcaccctatatgactaaagtggtcaaa
atgtggcgtaaactggggacctggctgtggcttgccacccaaaacctggcggattacccc
gatactgctgaaaagatgctgaatatggctgaatggtggctgtgtctgaccatgccaccg
gatgaagtggagcaaatcgcccggtttaagaaactgacggaagaggaaaaagccgtattg
ctctctgccagcaaattaccccgttgttatactgaaggtgtggtattagcgaaaaaaatc
gaagccttgtttcgggtggtgcccccaagcctgtatctggcgctggggatgacggaaaaa
gaagaaaaagccgagcgtagggcgttaatgcgtgaacatcagtgcagtgaactggaagcc
gcttttctggtggccagaaaaatggatatcgcacgggggttaaaggttgattccggttct
gtatga

DBGET integrated database retrieval system