KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3457Help
Entry
XBJ1_3457         CDS       T01186                                 

Gene name
ampE
Definition
(GenBank) putative transmembrane protein, protease
  KO
K03807  AmpE protein
Organism
xbo  Xenorhabdus bovienii SS-2004
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    XBJ1_3457 (ampE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AmpE SLC3A2_N
Motif
Other DBs
NCBI-ProteinID: CBJ82575
UniProt: D3V4J6
Position
complement(3365410..3366264)
Genome map
AA seq 284 aa AA seqDB search
MTLFILLLVLAWERVFKMGDHWQLERYLSPLFARMKLFSLWSSLGMTLLIALLTWKLIDV
LSDVVFGVPGILLYIMISLLCIGAGSLRYDYREYLRAVRLDELDQQNNHLVRLTMIQGTL
PDTTKDERLREIQNALIWINFRYYLAPIFWLVVMGKLGPAILMGYGFLRGYQGWLAQHGT
TVQRAQTGVDSLLHCLDWVPARLAGIAYALLGHGEKALPAWVASLSDLRTSQYKVVSQLA
QFALSKEPHLNPIETPVAAVRLAKKATLTIVIIVALLTIYGALA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgactctctttattctattgttagtactggcatgggaacgtgtttttaagatgggcgac
cattggcagttggaacgctatttgtcccctttgtttgccaggatgaaattattttcatta
tggagcagtttgggtatgaccctactgatcgcattactgacctggaaacttattgatgtt
ttgagtgatgtggtttttggtgtaccgggaattctgctgtatatcatgatcagcttgttg
tgtattggtgcagggtctttgcgttatgactatcgggaatatcttcgagctgtacgtctt
gatgaactggatcagcaaaataatcaccttgtccgtttgacgatgatacagggaactcta
cctgataccacaaaagatgagcgattgcgtgagatacagaatgcattgatctggataaat
ttccgttattatcttgcaccgattttctggttggtagtgatgggaaaattaggtcctgca
atcttaatgggatacggttttttgaggggttatcaaggatggttggcacaacacggaacg
actgtgcaacgtgcacaaactggggttgatagtttgctgcactgtctggattgggttcct
gctcgtctggcggggatcgcttatgctttattagggcatggggaaaaagccttgccagct
tgggttgcatccctcagtgatcttcggacatctcaatataaggtggtaagtcaattggct
cagtttgccttaagtaaggaacctcatcttaatccaatagaaactcctgttgcggctgtt
aggttagcgaaaaaggcgacattgactattgtgattattgttgcattgttgacgatctat
ggagcattagcttaa

DBGET integrated database retrieval system