KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3462Help
Entry
XBJ1_3462         CDS       T01186                                 

Gene name
coaE
Definition
(GenBank) dephospho-CoA kinase
  KO
K00859  dephospho-CoA kinase [EC:2.7.1.24]
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo00770  Pantothenate and CoA biosynthesis
xbo01100  Metabolic pathways
Module
xbo_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    XBJ1_3462 (coaE)
Enzymes [BR:xbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.24  dephospho-CoA kinase
     XBJ1_3462 (coaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoaE SKI AAA_18 AAA_17 AAA_28 AAA_33 Cytidylate_kin2 FRB_dom AAA_29
Motif
Other DBs
NCBI-ProteinID: CBJ82580
UniProt: D3V4K1
Position
3370494..3371117
Genome map
AA seq 207 aa AA seqDB search
MSYIIALTGGIGSGKTTISNVFSSLGVPLIDADIIAREVVAPGSPALQAIAEHFGSDILL
PDGSLNRVFLRQKIFAVPAEKQWINALLHPLIHTETQQQLSQVTAPYAIWVVPLLIENNL
MHLADRILVVDVPPEIQISRTMTRDGVSREQVENILAAQANRHERLEKADDVIFNHHNEQ
DIISRVAELHQQYLKQAESVRQENRNE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagttatattattgcactcacaggtggaattggtagcggtaaaacgactatctctaat
gtgttttcatcccttggtgtcccgcttattgatgcagatattatcgccagagaggttgtt
gctccgggttcccccgccttgcaggcaatcgcagagcactttggttctgacatattgctg
ccggatggcagtttaaatcgcgtctttctgcgccaaaaaatttttgcagttccagcagaa
aagcagtggatcaatgcacttctccacccgctgatacacacagaaacccaacagcaacta
agtcaagtcactgccccttatgccatttgggtcgttcctctgttaattgaaaataattta
atgcatttggcagatcgtattttagttgttgatgttccccctgaaatacagatcagccga
acaatgacacgtgacggagtaagtcgtgagcaagtcgagaacattctggctgcacaggcc
aaccgtcatgaaaggctggaaaaagcggatgatgtcatattcaaccatcacaatgagcag
gatatcatctcccgtgtggccgaattacaccaacagtatttgaaacaagcagaatcagtc
agacaggaaaatcgtaatgagtga

DBGET integrated database retrieval system