KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3463Help
Entry
XBJ1_3463         CDS       T01186                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K18778  cell division protein ZapD
Organism
xbo  Xenorhabdus bovienii SS-2004
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xbo03036]
    XBJ1_3463
Chromosome and associated proteins [BR:xbo03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    XBJ1_3463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ZapD APG17 PapC_N
Motif
Other DBs
NCBI-ProteinID: CBJ82581
UniProt: D3V4K2
Position
3371110..3371868
Genome map
AA seq 252 aa AA seqDB search
MSDATSTIIFEHPLNEKMRSWLRIDSSLQQLEKQQYLDSSASCLAFFRTIAELIEILERG
EVRSELLKELDRQQAKLKQWLGSPDVDTAMIHLLIEQLKERSIALNKAPRLSQHIKEDRI
INIVRKRLSIPGGCCSFDLPTLHLWLHLPQSVRDKTVKSWLDSLHPLQQALESILGLIRQ
SAIFSPKISHNGFYQGNADESDLLRLKLDVVLDALVYPQISGHKTRFAIRFLPMDSEHGV
VPAHLSFELACC
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgcaacctccactattatctttgaacacccactcaatgaaaaaatgcgttca
tggctgaggattgattcttcactgcaacaactggaaaaacagcagtatctagattcatcg
gcgagttgtctcgcgtttttccgtacaattgctgaattaatcgaaatactggaacgcggt
gaagttcgctctgaattattgaaagagctggatcgccaacaggcaaaattaaagcaatgg
ctcggttcgcccgatgttgatacggcgatgatccacctactgatagagcaactcaaggaa
cggagcatcgccttgaataaggctccacgtctcagccagcacattaaagaagatcgtatc
atcaacattgtgcgtaaacggcttagcatcccgggaggatgttgcagttttgacttaccc
acgttacacctgtggctacatttaccacagtctgtcagagataaaaccgtcaaatcttgg
ctggacagcctacacccattacagcaagcactggaaagcatcctggggttaatacgccaa
tccgccatattttctccaaaaatcagccacaacggtttctatcagggaaatgctgatgag
tctgatttattgagattaaagttagatgtcgtactggatgcactggtctatccacaaata
tccggtcacaagacccgttttgccatccgttttctgccgatggatagcgagcacggtgtt
gtacctgcacatttgtcatttgaattagcctgctgttaa

DBGET integrated database retrieval system