KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3464Help
Entry
XBJ1_3464         CDS       T01186                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09862  uncharacterized protein
Organism
xbo  Xenorhabdus bovienii SS-2004
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    XBJ1_3464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YacG zf-C6H2
Motif
Other DBs
NCBI-ProteinID: CBJ82582
UniProt: D3V4K3
Position
3371902..3372099
Genome map
AA seq 65 aa AA seqDB search
MSEVLTVACPTCAKTVIWGEINPYRPFCSKRCQLIDLGEWASEEKKIASQDDSSENDSWS
EEPDR
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagtattgaccgtcgcatgcccgacttgcgctaaaacggtaatatggggagaa
atcaacccatatcgcccattttgcagtaaacgttgccaattaatcgacttaggcgaatgg
gccagtgaagaaaaaaaaatcgccagtcaggacgacagctcagaaaacgatagctggagt
gaagaaccagatcggtaa

DBGET integrated database retrieval system