KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3465Help
Entry
XBJ1_3465         CDS       T01186                                 

Gene name
mutT
Definition
(GenBank) 7,8-dihydro-8-oxoguanine-triphosphatase, prefers dGTP
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
xbo  Xenorhabdus bovienii SS-2004
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:xbo03400]
    XBJ1_3465 (mutT)
Enzymes [BR:xbo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     XBJ1_3465 (mutT)
DNA repair and recombination proteins [BR:xbo03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    XBJ1_3465 (mutT)
 Prokaryotic Type
    XBJ1_3465 (mutT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX_4 NUDIX
Motif
Other DBs
NCBI-ProteinID: CBJ82583
UniProt: D3V4K4
Position
complement(3372156..3372560)
Genome map
AA seq 134 aa AA seqDB search
MEKKHLHIAAGIIKNTNDEIFITQRHADSHMGGFWEFPGGKLEQEEIPEQALIRELKEEV
GITVTHCELVETITHEFSDRNITLYFYLVDQWKNEPFGKEGQPSRWVLQTELIADEFPPA
NRSIVALLNKSGSH
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaaacatctgcatattgcggccggcatcattaaaaataccaatgatgagatt
tttatcactcagcgtcatgctgactcacatatgggcggcttttgggaatttccgggagga
aaacttgaacaggaagaaattccggagcaggcacttattcgggaattgaaggaagaagtg
gggatcacggtaacccattgtgaattggtggaaaccatcactcatgaattttctgacaga
aacatcacactctatttttaccttgtggatcaatggaaaaatgagccatttggtaaagag
gggcagccttcccgttgggttttgcaaaccgaattgatcgctgatgagtttccgccagca
aaccgcagcatagtggctttgctgaacaaaagcggatctcattaa

DBGET integrated database retrieval system