KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3467Help
Entry
XBJ1_3467         CDS       T01186                                 

Gene name
secA
Definition
(GenBank) preprotein translocase, ATPase secretion component (General Secretory Pathway)
  KO
K03070  preprotein translocase subunit SecA
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo02024  Quorum sensing
xbo03060  Protein export
xbo03070  Bacterial secretion system
Module
xbo_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    XBJ1_3467 (secA)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    XBJ1_3467 (secA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    XBJ1_3467 (secA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xbo02044]
    XBJ1_3467 (secA)
Secretion system [BR:xbo02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   XBJ1_3467 (secA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecA_DEAD SecA_SW SecA_PP_bind SEC-C DEAD DUF2764 Helicase_C Glu_syn_central BDV_P24 DUF2175
Motif
Other DBs
NCBI-ProteinID: CBJ82585
UniProt: D3V4K6
Position
complement(3374520..3377228)
Genome map
AA seq 902 aa AA seqDB search
MLIKLLTKIFGSRNDRTLRRLRKSVEIINHMEPDFEKLSDEELKAKTEQFRARLKAGESL
EKILPEAFATVREASKRVFGMRHFDVQLLGGMVLNERCIAEMRTGEGKTLTATLPAYLNA
LGGRGVHVVTVNDYLAQRDAENNRPLFEYLGLTVGINLPNMPAPAKREAYAADITYGTNN
EYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTPLIISGPAEDSSELYIKVD
KLIPKLIRQEKEDSEAFQGEGHFSVDEKTRQVNLTERGLVLVEELLVGAKLMDEGESLYS
PTNIMLMHHVTAALRAHVLFTRDVDYIVKDGEVIIVDEHTGRTMQGRRWSDGLHQAVEAK
EGVEIQNENQTLASITFQNYFRIYEKLAGMTGTADTEAFEFSSIYKLDTIVVPTNRPMIR
KDLPDLVYMTEAEKIDAIIEDIKERTNNGQPILVGTISIEKSEVIAKALTKAGIEHNVLN
AKFHAMEADIIAQAGQAGTVTIATNMAGRGTDIVLGGSWQSEIAKLEEPSQEKIEQIKAA
WQERHDEVLAAGGLHIIGTERHESRRIDNQLRGRAGRQGDAGSSRFYLSMEDSLMRIFAS
DRVTGMMRKLGMQPGESIEHPWVTKAIANAQRKVESRNFDIRKQLLEYDDVANDQRRAIY
AQRNDLLDVGDVSETIASIREDVFKVTIDAYIPPQSLEEMWDIEGLHERLVNDFDLDMPI
KEWLDKEPELHEETLRERILEKAIEVYKQKEEIVSTEMMRNFEKGIMLQTLDTLWKEHLA
AMDYLRQGIHLRGYAQKDPKQEYKRESFAMFANMLESLKYEVISTLSKVQVRIPEEVEAL
ENQRREEAERLAKKQHLSHEVEQGALMSETEAQMASGARKLGRNDPCPCGSGKKFKHCHG
SL
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgctgattaaattactcactaagatttttggtagccgtaatgaccgtaccctacgccgt
ttgcgtaaatcggttgagattatcaaccatatggagcctgattttgagaagctctccgat
gaagaattaaaagcaaaaacagaacaattccgtgcacgcctgaaagcaggtgaatcactg
gagaaaattttgcctgaagcctttgctactgtacgcgaagccagtaagcgtgtattcggt
atgcgtcactttgatgtgcagttgctgggtgggatggtgctgaacgaacgctgtattgcg
gagatgcgtacaggtgaaggtaaaactctgaccgcaacactgccagcttaccttaatgcc
ttgggtggacgtggtgttcatgtcgtgactgtgaacgactatctggcacagcgtgacgcc
gaaaacaatcggccattgtttgaatacctcggtctgaccgtcggtattaacctgccaaac
atgccagcccctgcaaaacgcgaagcctatgccgcagatattacttacggcaccaacaat
gaatacggtttcgactacctgcgagacaacatggcgtttagcccagaagagcgagtacaa
cgcaaactgcactatgcgctggtggatgaggtggattcgatcctgatcgatgaagcccgt
accccgttgattatttctggaccagcggaagacagttctgaactttacatcaaagtggac
aaactgatacctaaactgatccgccaagaaaaagaagattcagaggcattccagggagaa
ggtcacttctcggttgatgaaaaaacacgtcaggttaacctcactgagcgtggtctggtt
ctggttgaagaactgctggttggtgccaaattgatggatgaaggcgaatcactgtattcg
ccgaccaacatcatgctgatgcaccatgtaacagcagcgctgcgtgcccacgttttgttt
actcgcgatgtagattacatcgtcaaagatggtgaagtcatcattgtcgatgagcacacc
gggcgtaccatgcagggacgtcgctggtctgatggactgcatcaggcggttgaggcgaaa
gaaggtgttgaaattcagaatgaaaaccagacactggcctctattacatttcagaactac
ttccggatatatgaaaaactggcaggtatgacgggaaccgctgatacagaagcctttgaa
ttcagttctatttataaactggatactatcgttgttccgacaaaccgtccgatgatccgt
aaagatttgccggatctggtctacatgaccgaagcggaaaaaatcgatgcgatcattgaa
gacattaaagaacgcaccaataatggtcagcctatattggtagggacaatttcgattgag
aaatcggaagtcattgctaaagcattaaccaaagcaggcattgaacataacgtcttgaat
gccaaattccatgcaatggaggcggatattatcgcacaggccggacaggctggcacggtt
actatcgcgactaacatggctggacgtggtacggatattgtgttgggcggaagctggcag
tctgaaatcgccaaactggaagaaccaagccaagagaaaatcgagcaaattaaagctgca
tggcaagaacgtcatgatgaagtacttgcagcgggcggtttgcatattattggtacagag
cgtcatgaatcacggcgtatcgataaccagttacgtggccgtgcgggacgtcagggggat
gctggttcttcgcgcttctatctctcaatggaagactccttgatgcgtatttttgcttcc
gatcgtgtcactggcatgatgcgtaaacttggcatgcagccgggtgaatcgattgaacac
ccatgggttactaaagcgattgccaatgcccagcgtaaagtagaaagccgtaacttcgat
attcgtaagcaattgctggaatatgatgatgttgccaacgatcagcgccgtgcgatttat
gcccaacgcaacgatctgcttgatgtgggtgatgtcagcgaaaccattgccagtattcgt
gaagatgtcttcaaggtaacgattgacgcctatattccgccacaatctctggaagaaatg
tgggatatagaaggtttacatgagcgtctggtaaacgactttgatctggatatgccgatc
aaggagtggctggacaaagaacctgaattgcacgaagaaacgctgcgtgaacgtattctt
gaaaaggcgattgaagtttacaaacagaaagaagaaatcgtcagtacagaaatgatgcgt
aactttgaaaaaggcatcatgttgcaaaccttggatacgctgtggaaagagcacttggct
gcgatggactacctgcgccaaggtattcatctgcgtggctatgcacagaaagatccaaag
caggagtataaacgcgaatcttttgccatgtttgctaatatgctggaatcgctgaaatat
gaagtgatcagtacattgagtaaagttcaggtcagaataccggaagaagtggaagcgctt
gagaatcagcgccgtgaagaagcggagcgtttggcaaagaaacagcatttgagccatgaa
gttgagcaaggcgctttaatgtcagaaacagaagcacagatggcgagtggcgcacgtaaa
ctgggacgcaacgatccttgcccatgtggctcaggcaaaaaatttaagcattgccacggc
agtttataa

DBGET integrated database retrieval system