KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3468Help
Entry
XBJ1_3468         CDS       T01186                                 

Gene name
secM
Definition
(GenBank) secretion monitor, regulator of secA translation (General Secretory Pathway)
  KO
K13301  secretion monitor
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo03060  Protein export
xbo03070  Bacterial secretion system
Module
xbo_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    XBJ1_3468 (secM)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    XBJ1_3468 (secM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xbo02044]
    XBJ1_3468 (secM)
Secretion system [BR:xbo02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   XBJ1_3468 (secM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecM DUF2547 DUF4084
Motif
Other DBs
NCBI-ProteinID: CBJ82586
UniProt: D3V4K7
Position
complement(3377339..3377875)
Genome map
AA seq 178 aa AA seqDB search
MSILNLWRQFGRRYFWSHLLLGMVATGIGVPAVLAGITESLPHSNTSSSQKNQNQVFSSF
DHLFQLQSVQRQPSNHLNYWQQHAVRNIIRRLSFTFSITGPIQHEVAKESIRFSSPCMQQ
LMLDTLYAMLIQAPSQFESILDIEITATILPDSHTPALWVAKTQGIRAGPTANHLSLL
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgagtattttaaatctttggcgacaatttggtaggcgttatttttggtctcacctttta
ctgggcatggtcgccacaggaattggtgttcctgctgttttagctggaataacagaaagc
cttcctcatagtaatacttcttccagccaaaagaaccaaaatcaggtattttcctcattt
gatcacttatttcaattacaaagtgtccagcgtcaaccttcgaatcatttgaattactgg
cagcaacatgctgttcgcaacattattcgtcggctttcttttactttttctattactggc
cctatccaacacgaagtagcaaaagaaagcattcgattttcttctccatgcatgcaacaa
cttatgctggatacgttgtatgctatgctgatacaagcaccgtcacaatttgaatccatc
cttgatattgaaattacggcgactattcttcctgattcccacacaccggcactctgggta
gctaaaactcagggaattcgcgcggggccaacagctaaccatttatctttgctttaa

DBGET integrated database retrieval system