KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3469Help
Entry
XBJ1_3469         CDS       T01186                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xbo  Xenorhabdus bovienii SS-2004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DciA
Motif
Other DBs
NCBI-ProteinID: CBJ82587
UniProt: D3V4K8
Position
3377913..3378449
Genome map
AA seq 178 aa AA seqDB search
MRDSRPQSLDTLFEDEAAVGKSPLQIIQQHAIALLKLNRAMLSLLPAQLHPWCRVANYRK
HILVLEAGNASWMTRLRYEVPVLLSTLRSEILPSLSSIDIRINPSLMVKRSNNAQDFAKS
STTAPNNNNQNLPKRQLSHESAETLMILAERSPEKLKRKLERLAALAGEGTSTAKKKC
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgcgagatagccgaccacaatcactggatacgctatttgaagatgaggcagctgtcggt
aaaagccctcttcaaatcattcaacaacatgctattgcacttttgaaactcaaccgtgcc
atgctcagtttattgcccgcacaactgcatccatggtgcagggtcgccaattatcgcaaa
catattctggtactggaagcaggaaatgccagttggatgacaagacttcgctatgaagtg
cccgttttgctttcgacactgagaagcgaaattctaccatctttatcctctatcgacatc
aggattaatccatcattaatggtcaaacgtagtaataatgcgcaagatttcgcaaaatcg
tcaacaacagcacctaataataataatcagaatttaccaaagcgccaattgagccatgaa
agtgcagaaacattaatgatattggctgaacgcagccctgagaaattgaaaaggaaatta
gagagattggctgcgctggccggagagggtaccagtacagccaaaaaaaagtgctag

DBGET integrated database retrieval system