KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3471Help
Entry
XBJ1_3471         CDS       T01186                                 

Gene name
ftsZ
Definition
(GenBank) tubulin-like GTP-binding protein and GTPase, forms circumferential ring in cell division
  KO
K03531  cell division protein FtsZ
Organism
xbo  Xenorhabdus bovienii SS-2004
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xbo03036]
    XBJ1_3471 (ftsZ)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:xbo04812]
    XBJ1_3471 (ftsZ)
   02048 Prokaryotic defense system [BR:xbo02048]
    XBJ1_3471 (ftsZ)
Chromosome and associated proteins [BR:xbo03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    XBJ1_3471 (ftsZ)
Cytoskeleton proteins [BR:xbo04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   XBJ1_3471 (ftsZ)
Prokaryotic defense system [BR:xbo02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    XBJ1_3471 (ftsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin FtsZ_C NAD_binding_10 Tubulin_2
Motif
Other DBs
NCBI-ProteinID: CBJ82589
UniProt: D3V4L0
Position
complement(3379557..3380720)
Genome map
AA seq 387 aa AA seqDB search
MFEPLELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVDFFAINTDAQALRKTAVGQTIQI
GNGITKGLGAGANPEVGRTAAEEDREALRTALEGADMVFIAAGMGGGTGTGAAPVVAEIA
KELGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRGISLLD
AFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGISQGEDRAEEAA
EMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDP
DMNDELRVTVVATGIGMDKRPEITLVTNNKVSQSNTLDRRYPQMSGGIPSLSEEKKTAAK
VVNDQNAQTSKEPDYLDIPAFLRKQAD
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaccactggaattaaccaacgacgcggtgattaaagtcatcggcgtcggcggc
ggcggcggtaatgctgttgagcacatggtgcgtgaacgtattgaaggtgtagacttcttt
gcgattaacaccgatgctcaggcgctgcgcaaaacagctgtcggtcagactatccagatt
ggcaacggcattacaaaaggattgggcgctggtgcaaaccctgaagtcggccgtactgcg
gcagaagaagatcgcgaagcattgcgtactgccctggaaggtgccgacatggtattcatc
gctgccggcatgggcggtggtacgggaactggcgcagcccccgttgtggctgaaattgct
aaagagcttggtattctgaccgttgctgtcgttaccaagccattcaatttcgaaggcaag
aagcgaatggccttcgcggaacaggggatcactgaactgtccaaacatgtggactcattg
atcaccattccaaatgacaaattattgaaagtgctgggacgcggcatttctctgctggat
gcattcggtgcagccaatgacgtcctgaaaggggcggttcaaggtatcgctgaactgatt
actcgcccgggactgatgaacgttgatttcgcagacgttcgtaccgtgatgtctgaaatg
ggatatgccatgatgggatcaggtatttcacagggtgaagaccgtgcagaagaagcggct
gaaatggctatctccagcccgttactggaagatattgatctttctggtgcacgtggagtg
ttggttaacattactgccggctttgatttgcgtctggatgagtttgaaacggttggtaac
acaattcgtgcatttgcctctgacaatgcgacagtggttatcggtacgtcactggatcca
gacatgaatgatgagctacgtgtaacggttgtggcaacgggtatcgggatggacaaacgt
cctgaaattactctggtgaccaacaacaaagtatctcagtcaaatacactggatcgccgt
tacccgcagatgtctggtggaatcccgtcattgtctgaagagaaaaaaactgctgcaaaa
gtggtcaatgatcaaaatgcgcagacaagcaaagagcctgattatctggacattccagca
tttttgcgcaaacaggctgattaa

DBGET integrated database retrieval system