KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3476Help
Entry
XBJ1_3476         CDS       T01186                                 

Gene name
murG
Definition
(GenBank) UDP-N-acetylglucosamine:N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo00550  Peptidoglycan biosynthesis
xbo01100  Metabolic pathways
xbo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    XBJ1_3476 (murG)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    XBJ1_3476 (murG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xbo01011]
    XBJ1_3476 (murG)
Enzymes [BR:xbo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     XBJ1_3476 (murG)
Peptidoglycan biosynthesis and degradation proteins [BR:xbo01011]
 Precursor biosynthesis
  Glycosyltransferase
   XBJ1_3476 (murG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_28 Glyco_tran_28_C Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4 Glyco_trans_4_2 OTCace
Motif
Other DBs
NCBI-ProteinID: CBJ82594
UniProt: D3V4L5
Position
complement(3385317..3386402)
Genome map
AA seq 361 aa AA seqDB search
MSGRNRRLMVMAGGTGGHVFPGLAVAQHLKEQGWEIRWLGTADRMEADLVPKQGIDIEFI
QISGLRGKGIKALFAAPVRIFKAIRQAKTIMRRYQPDVVLGMGGYVSGPGGIAAWLCGIP
VVLHEQNGIAGLTNRWLAKIAKTVLQAFPGAFSDAPVVGNPVREDVLALPVPAQRLAGRE
GSIRVLVVGGSQGARILNQIMPEVAERMGVHITIWHQAGKGAQEETHRKYENSAKSEFKV
TEFIDDMAQAYAWADIVVCRSGALTVSEVSAAGLPAIFVPFQHKDRQQYWNALPLEKAGA
AKILEQPQFTAEAVVDLLTQWQRPQLLEMAEKARSVAIVNATERVAAALIDAVENYSGRS
K
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcagaaaccggcgtttaatggtaatggctggtggtacgggaggccatgttttt
ccgggactggcggttgcccaacatttaaaagaacaaggctgggaaatccgctggttggga
accgctgatcgcatggaggcggatttggttcctaaacagggtattgatattgaatttatc
caaatttcaggattgcgtggcaaaggaataaaagcactctttgcggctcctgtcagaatt
tttaaggcgatccggcaggcaaaaacgatcatgcgccgctatcagccggacgttgtgctg
ggtatgggtggctatgtctcaggacccggcggaattgctgcatggctgtgtggcattccg
gttgttctgcatgaacagaatggtattgccggattaaccaaccgctggctggccaaaatt
gcgaaaacggtcttgcaggcatttcccggcgcattttctgatgcacctgttgtcggcaac
cctgtgcgtgaagatgtactggcgctgccagtgcctgcacagcgtctggcaggaagagaa
ggatctatccgtgtactggtcgttggaggtagtcagggtgcaagaattctgaatcaaatc
atgccagaagtggctgagcgtatgggtgttcacatcactatatggcatcaggcaggaaaa
ggtgcgcaggaagaaacacacagaaaatatgaaaattcagctaaatctgaatttaaagtg
actgaatttattgatgatatggcgcaggcttatgcgtgggctgatatcgtggtgtgtcgt
tcgggtgcattgacggtcagcgaagtttctgcagcaggattacctgcgatctttgtgcca
tttcaacataaagatcgccagcaatattggaatgctttaccgctggaaaaagcgggagca
gcaaaaatacttgaacagcctcaatttacggccgaagccgtagtagatctgctcacacag
tggcagcgtccacaattgctggaaatggcagaaaaagcgcgttcagtagccatcgttaat
gcaactgagcgtgtggcagcagcattgatcgatgctgttgaaaattattcaggccgttcc
aagtag

DBGET integrated database retrieval system