KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3483Help
Entry
XBJ1_3483         CDS       T01186                                 

Gene name
ftsL
Definition
(GenBank) cell division protein; ingrowth of wall at septum
  KO
K03586  cell division protein FtsL
Organism
xbo  Xenorhabdus bovienii SS-2004
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xbo03036]
    XBJ1_3483 (ftsL)
Chromosome and associated proteins [BR:xbo03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    XBJ1_3483 (ftsL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsL TMEM154
Motif
Other DBs
NCBI-ProteinID: CBJ82601
UniProt: D3V4M2
Position
complement(3394637..3394954)
Genome map
AA seq 105 aa AA seqDB search
MAGERHGLVGVIGRDLIRNAKIPLVLLIAVIISAISVVTVAHKTRLLIAEKERSAIDFDS
LDIEWRNLLLEENALGDHSRVENIATETLHMQHVDPAQENIVITQ
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtgagcgtcatggattagtgggggtcattggcagggatttaatccgcaatgcc
aagatcccactggttttgctgatagcggtaatcatttcggccattagcgttgtgacggtt
gcccataaaacccgcttattgatagcggaaaaagagcgctcggcgattgattttgattct
ctggatattgagtggcgtaacctgcttcttgaagagaatgccctcggtgatcacagtcgc
gttgaaaatatagcgactgaaacattgcatatgcaacatgttgatccggcgcaagaaaat
attgttataactcaataa

DBGET integrated database retrieval system