KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3486Help
Entry
XBJ1_3486         CDS       T01186                                 

Gene name
fruR
Definition
(GenBank) transcriptional regulator of the control of carbon and energy metabolism (GalR/LacI family)
  KO
K03435  LacI family transcriptional regulator, fructose operon transcriptional repressor
Organism
xbo  Xenorhabdus bovienii SS-2004
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xbo03000]
    XBJ1_3486 (fruR)
Transcription factors [BR:xbo03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    XBJ1_3486 (fruR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LacI Peripla_BP_1 Peripla_BP_4 Peripla_BP_3 HTH_3 PucR
Motif
Other DBs
NCBI-ProteinID: CBJ82604
UniProt: D3V4M5
Position
complement(3397009..3398016)
Genome map
AA seq 335 aa AA seqDB search
MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREHNYHPNAVAAGLRAGR
TRSIGLVIPDLENTSYTRIANYLERQARQRGYQLLIACSEDQPDNEMRCVEHLLQRQVDA
IIVSTALPPEHPFYQRWTNRSLPIIALDRALDSEHFISVVGDDLEDAKMLAQELRQFPSE
SVLYLGALPELSVSFLREQGFREAWESDQREVNYLYANSYEREAAAEVFASWLENNPVPQ
VLYTTSFSLLQGVMDTLLKRSGRLPEQLVIATFGDHELLDFLECPVLSVAQRHRDVAECA
LELVLASLDEKKRPEPGITRMRRHLCRRGSLSRKA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactggatgagatcgcccgcttagcaggggtttcacgtaccacggccagttatgtt
atcaatggtaaagccaagcagtaccgggtcagcgataaaacagtagaaaaagtgatggcg
gtggtcagagagcacaattaccatcccaatgctgttgccgccggtcttcgggcggggcgt
actcgttcaattggcttagtgataccggatttggaaaacacgagctatacccgaattgcc
aactatcttgagcgtcaggcacggcaacgtggataccagctattgatcgcatgttctgaa
gatcagccagataacgaaatgcgctgtgttgagcatcttctgcaacggcaggttgatgcc
attattgtttccactgcgttgcctcctgaacatcctttctatcaacgttggacaaaccgt
tcactgccaattattgcgcttgatcgtgcattggacagcgaacactttatcagtgttgtg
ggggatgacctcgaagatgcgaaaatgctggcacaggagctgcgtcaatttccgtcagaa
tctgttctttatctgggagcattacctgaattatcggtcagtttcttacgtgaacagggg
tttcgtgaagcatgggaaagtgatcagcgtgaagtgaactacctgtatgcgaacagctat
gaacgtgaagctgcggctgaagtctttgcttcatggctggaaaataatcctgtacctcaa
gtactctacacaacctcattttccttgctgcaaggcgtcatggataccctccttaagcgc
agtggtcggttacctgagcagttggtcattgctacgttcggtgatcatgaattacttgat
tttcttgaatgtccggtgctgtccgtcgcacaacgccaccgtgacgtggctgaatgtgcc
cttgaactggtattggccagtttggatgaaaaaaagcggccagagccaggaataactcga
atgcgtcgtcatttatgccgtcgtggaagcctgagtagaaaagcttga

DBGET integrated database retrieval system