KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3489Help
Entry
XBJ1_3489         CDS       T01186                                 

Definition
(GenBank) putative long-chain-fatty-acid--CoA ligase (Long-chain acyl-CoA synthetase) (LACS)
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo00061  Fatty acid biosynthesis
xbo00071  Fatty acid degradation
xbo01100  Metabolic pathways
xbo01212  Fatty acid metabolism
xbo02024  Quorum sensing
Module
xbo_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    XBJ1_3489
   00071 Fatty acid degradation
    XBJ1_3489
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    XBJ1_3489
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:xbo01004]
    XBJ1_3489
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xbo04147]
    XBJ1_3489
Enzymes [BR:xbo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     XBJ1_3489
Lipid biosynthesis proteins [BR:xbo01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   XBJ1_3489
Exosome [BR:xbo04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   XBJ1_3489
  Exosomal proteins of breast cancer cells
   XBJ1_3489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: CBJ82607
UniProt: D3V4M8
Position
complement(3400520..3402322)
Genome map
AA seq 600 aa AA seqDB search
MITDSLHSYHLINRLQQQSIEYPEKIAFRQWSPSEQLEMSWQDVTYRTESIAKALLSLGV
EIQEKVAIFAHNCIAWSLADLAVLQLRAVTVPLYATSSRDQATFILKDAGVRVLFVGEQE
QYNVAMTLLELCPQLNHLIVLDESVDLKSCPQAQYLSAFIVNAHAQYQPELDNRIAGQDL
NDLFTLIYTSGTTGEPKGVMLDYHNIASQLYLHDQRLTLTKEDVSLSFLPLSHIFERAWS
YYVMHTGALNVYLTDTNSVREAMAEVRPTVMCAVPRFYEKVHSAILEKVSRAPFLRRLIF
RWAIKRGENRWMRQLQNKKACIFSLCSDQLADKLVLSKLRNIFGGRVRFLPVAGARLDDA
IARFFLSAGINIKYGYGMTETCATVSCWEEKNYLPGSIGTPLPSIDVRISAEDEIQVRGP
IVMKGYFNQPEETAHAFTEDGWLRTGDAGGLDETGNLFITERLKDLMKTSTGKYIAPQML
EGTLGQDRFIEYIAVIADSRNFVSALIVPSYDALEDYAKSIHLHYRDRIELLNNRQIIEL
FEQRLAELQKNIAKYHQVKRFILLPEAFSMEKGELTPTLKLRRKVISQHYHDEIESMYRD
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
gtgataacagattccctgcattcctatcacctgattaaccggttgcaacagcaatccatt
gaatatcccgaaaagattgcattcaggcaatggtcaccatcagagcagcttgaaatgagt
tggcaagacgttacttatagaacggaatccatcgcaaaagctttgttgtcactgggtgta
gaaattcaggagaaagtcgctatttttgcgcataactgtattgcatggtcattggctgat
ttggccgttcttcagttacgtgcggttacagtccctctttatgcgaccagcagccgtgat
caggctaccttcattctcaaggatgccggtgtgcgggtactgtttgttggtgagcaagaa
caatataatgttgcgatgacattgctggaattgtgccctcaactcaatcatcttattgtg
ctggacgagtccgttgacttgaagagctgtccgcaggcgcagtatttatctgccttcatt
gtcaatgcgcacgcacaatatcagccagagcttgataaccgcattgcagggcaggattta
aatgatcttttcaccttgatctacacctccggtacaacgggagagccaaaaggagtgatg
ctggattaccacaatatcgcttcgcagctttacttgcatgatcagcgtctgacactgacc
aaagaagatgtatcactcagttttttaccgttgtcccatatcttcgagcgcgcatggagt
tactatgtcatgcatacaggggcgcttaatgtctatttaactgacaccaattctgtgcgc
gaggcgatggctgaagtacgtcccactgttatgtgcgctgttccccgtttttatgaaaaa
gtgcatagtgctattcttgaaaaagtttcccgtgcgccatttttgcgcaggctgattttc
cgctgggcgataaagcggggggagaaccgctggatgcgtcagctacagaataaaaaagcg
tgtatcttctctctctgtagtgatcaactggccgacaaactagtgttgagcaagctccgt
aacatatttggagggcgagtgcgtttcttacccgtggcaggagcacgtcttgacgatgct
attgcccggttttttctatccgccggcattaatatcaaatatggttacggcatgacagaa
acttgtgccacggtatcttgctgggaagagaaaaactatctcccaggctcgattggcaca
ccattgccgagtattgatgtgcgcatcagtgccgaagatgaaattcaggtacgtggccct
attgtgatgaaaggctatttcaaccagccggaagaaacggctcatgcttttaccgaagat
ggatggctgcgtacgggggatgcagggggattggatgaaacaggcaatttgttcatcact
gagcgcctgaaagatttgatgaaaacctcgacgggaaaatacattgctccgcaaatgctt
gaggggactttgggacaggatcgtttcattgaatatattgcggttattgccgattcccgt
aattttgtttctgcgttgattgtccccagttatgatgcattagaagattacgcaaaatcc
atccatcttcattatcgtgatcgtatcgagttgctgaacaatcgtcagatcatcgaactg
tttgaacaacgtttggcggaactacaaaaaaatattgccaaataccatcaggtaaaacgc
ttcatcctactgccagaagctttctccatggaaaaaggcgaattaactcctacactgaaa
ctgcgccgtaaggtgatttcgcaacattatcacgatgaaatcgaatccatgtatcgagat
taa

DBGET integrated database retrieval system