KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3511Help
Entry
XBJ1_3511         CDS       T01186                                 

Gene name
talB
Definition
(GenBank) transaldolase B
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo00030  Pentose phosphate pathway
xbo01100  Metabolic pathways
xbo01110  Biosynthesis of secondary metabolites
xbo01120  Microbial metabolism in diverse environments
xbo01130  Biosynthesis of antibiotics
xbo01200  Carbon metabolism
xbo01230  Biosynthesis of amino acids
Module
xbo_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
xbo_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    XBJ1_3511 (talB)
Enzymes [BR:xbo01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     XBJ1_3511 (talB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TAL_FSA
Motif
Other DBs
NCBI-ProteinID: CBJ82629
UniProt: D3V4Q0
Position
complement(3419241..3420194)
Genome map
AA seq 317 aa AA seqDB search
MTDKLTSLRKLTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQIPEYRQLINEAIEWAR
GQSDSREQQIIDAGDKLAVNIGLEILKLIPGRISTEVDARLSYDTEASVAKAKRLIKLYN
EAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQARACAEAGVYLISPFVG
RILDWYKANGDKKEFAPHEDPGVISVAEIYQYYKEHGYNTVVMGASFRNSGEILELAGCD
RLTISPALLKELSETAGEVECKLGYEGEIKARPARLTEAEFYWEHHQDAMATEKLAEGIR
KFAVDQGKLESMIADLL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaccgataaactgacttccctgcgtaaactgacaacagtcgtagcagatactggggat
atcgcggcaatgaagctgtatcagccgcaagatgcaaccaccaacccttccttgattttg
aacgcagctcaaatccctgaataccgccaactgattaatgaagccattgaatgggcgcgt
ggtcagagcgattctcgtgagcagcagattattgatgccggcgacaaattggcagtcaat
attggtctggaaattctgaaactgatccctggccgcatttccaccgaagttgatgcgcgc
ctttcttatgacactgaagccagcgtagcgaaagcaaaacgtttgatcaaactgtacaac
gaagcgggtattagcaatgaccgcattctgatcaaactggcttctacatggcagggtatc
cgtgcggcggagcaactggaaaaagaaggcatcaattgtaacctgaccctgctgttctct
tttgctcaggcgcgcgcttgtgcggaagcgggtgtttatctgatttctccgtttgttggc
cggatccttgactggtacaaagcgaatggcgataagaaagaattcgcaccacatgaagat
ccgggcgtgatctctgttgctgaaatttaccagtactacaaagaacatggttataacacg
gtggttatgggcgcaagtttccgtaattccggtgaaattctggaactggctggctgtgac
cgtctgactatctctcctgcgctgctgaaagaattatctgaaacagcaggtgaagttgag
tgcaaactgggttatgaaggcgagatcaaagcgcgtccagctcgattgacagaagctgag
ttctactgggaacaccatcaggatgcgatggcgaccgaaaaactggcggaaggtattcgt
aaatttgccgtagatcagggcaagcttgagagcatgatcgctgatctgctgtaa

DBGET integrated database retrieval system