KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3514Help
Entry
XBJ1_3514         CDS       T01186                                 

Gene name
thrB
Definition
(GenBank) homoserine kinase
  KO
K00872  homoserine kinase [EC:2.7.1.39]
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo00260  Glycine, serine and threonine metabolism
xbo01100  Metabolic pathways
xbo01110  Biosynthesis of secondary metabolites
xbo01120  Microbial metabolism in diverse environments
xbo01230  Biosynthesis of amino acids
Module
xbo_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XBJ1_3514 (thrB)
Enzymes [BR:xbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     XBJ1_3514 (thrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: CBJ82632
UniProt: D3V4Q3
Position
complement(3422512..3423462)
Genome map
AA seq 316 aa AA seqDB search
MEIGGLMVVRIYAPASIGNVGVGFDVLGAAVSPVDGSLLGDCVSVCEAEHFSLSNEGRFA
DKLPADPKHNIVYQCWQLFCQHLGKELPVAMTLEKNMPIGSGLGSSACSVVAALVALNKY
ADCPFDSNQLLDMMGELEGRISGGVHYDNVAPCYLGGLQLLLAQKNAVCQFVPTFDDWLW
VMAYPGIKVSTSEARGILPANYPREDMIEHGRYFAGFIHACHTQQSELAAKLMKDVVAEP
YRTQLLPGFANARDGVKKRGALACSISGSGPTLFAICNDMAVAKEVAQWLQQHYVQNDEG
FVHICRLDLAGARQVE
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgggggtttaatggtggtcagaatttatgcacccgcctctatcgggaacgtt
ggcgttgggtttgatgtgctcggcgcagcggtttctcctgttgatggctcgttgcttgga
gattgcgtctctgtctgtgaagctgaacatttcagtttaagtaatgaagggcggtttgcc
gacaaattgcctgctgatcccaaacacaacattgtttatcaatgctggcagcttttttgc
cagcatctgggaaaagagctgcctgttgccatgacactggaaaaaaacatgccgattggt
tcagggctgggttccagtgcctgttcggtggttgctgctctggtggcattgaataagtat
gctgactgtccatttgacagcaaccaattgttggacatgatgggcgagttggagggacgt
atttccggcggtgtacactatgataatgtcgctccatgctacttaggggggttgcaactg
ctccttgcgcagaaaaatgccgtttgtcagtttgttcctacttttgatgattggttgtgg
gtgatggcttaccccggcatcaaagtttcgacatcagaagcccgtggcattctgccggca
aattacccccgtgaggatatgattgagcacggtcgttattttgcgggatttattcacgcc
tgtcatacccagcaatccgaactggcggctaaattgatgaaagatgtcgttgctgaacct
tatcgcacacaacttttacccggatttgccaatgcgcgtgatggagtaaagaaacgagga
gctctggcgtgcagtatttcgggttctgggccgacattatttgcgatctgcaatgacatg
gctgtagcgaaagaagtcgcacagtggctgcaacaacattacgtacaaaatgatgaaggt
tttgtgcatatttgccgtctggatctcgcaggcgcacgacaggtagagtaa

DBGET integrated database retrieval system