KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3518Help
Entry
XBJ1_3518         CDS       T01186                                 

Definition
(GenBank) Protein creA
  KO
K05805  CreA protein
Organism
xbo  Xenorhabdus bovienii SS-2004
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    XBJ1_3518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CreA
Motif
Other DBs
NCBI-ProteinID: CBJ82636
UniProt: D3V4Q7
Position
complement(3427529..3428005)
Genome map
AA seq 158 aa AA seqDB search
MVTIKKIVIAAALIFSPVILHAEEIGSVDTVFKLFGPDNKIVIEAFDDPDVKNVTCYLSR
AKTGGIKGGLGLAEDTSDAAISCQQVGPIELSDKIKTSPKKGQVVFQKRTSLVFKKLQVV
RFYDPKRSSLIYLTYSDKVIDGSPKNAISAVPMMPWKE
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggtaacaatcaagaaaatagtaatagcggctgccttgatcttttctcctgtgatcctg
catgctgaggagatcggttctgtcgataccgtgttcaaactattcggtcctgataacaaa
atagtaatagaagcttttgatgatcctgatgtcaaaaatgtcacctgttatctgagcagg
gctaagacaggcgggatcaaaggcggattggggttggcagaagatacttctgatgccgct
atatcctgccagcaggtcgggccgattgaattgagcgacaaaatcaagacatctcccaaa
aaagggcaggttgttttccaaaaacgtacatctctggtgtttaaaaaacttcaggtggtt
cgtttctacgatcctaaacgtagttctctgatttatttaacttattctgataaagtcatc
gacgggtcgcctaaaaatgcgatcagtgcggtgccgatgatgccgtggaaagagtga

DBGET integrated database retrieval system