KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3522Help
Entry
XBJ1_3522         CDS       T01186                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xbo  Xenorhabdus bovienii SS-2004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTPase_I-T
Motif
Other DBs
NCBI-ProteinID: CBJ82640
UniProt: D3V4R1
Position
3430289..3430822
Genome map
AA seq 177 aa AA seqDB search
MYHVIAATTNPAKIKAINLAFDDVFGPGTYRIEDVNVDSSVPQQPIGNTETRTGARHRVM
AARQVRPEADFWVGVEAGIEDDMTFAWMVIEYKQIRGESRSASLMLPEKVLEGIREGREL
GHEMAYLTGVDNIKQKGGAIGFFTNGILTRTSVYHQALILALVPIHHEIYKELNNQP
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacgttattgctgcaacaactaaccctgcaaaaataaaagcgattaaccttgca
ttcgatgatgtttttggccccggcacttaccgcatagaagatgtcaacgtagacagcagc
gtccctcaacaacccattggcaatactgagacccgtaccggtgcccgtcaccgcgtgatg
gcagcccgtcaggttcggccagaagccgatttttgggttggagttgaagctggaattgaa
gatgacatgacgttcgcctggatggttatcgaatacaagcaaattcggggtgagtcgcgc
tctgccagtctgatgctgcctgaaaaagtattggaaggcattcgtgaaggacgcgagctt
ggccatgaaatggcttatttgaccggcgtcgataatatcaagcagaaaggtggcgcaatc
ggcttttttactaacggtattcttacccgcaccagcgtttatcatcaggcgctgatattg
gctcttgttcctattcatcatgaaatttacaaagagttgaataaccaaccttaa

DBGET integrated database retrieval system