KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3567Help
Entry
XBJ1_3567         CDS       T01186                                 

Gene name
efp
Definition
(GenBank) elongation factor P (EF-P)
  KO
K02356  elongation factor P
Organism
xbo  Xenorhabdus bovienii SS-2004
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:xbo03012]
    XBJ1_3567 (efp)
Translation factors [BR:xbo03012]
 Prokaryotic Type
  Elongation factors
   XBJ1_3567 (efp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Elong-fact-P_C EFP_N EFP Ubiquitin_3
Motif
Other DBs
NCBI-ProteinID: CBJ82685
UniProt: D3V4V6
Position
complement(3473332..3473898)
Genome map
AA seq 188 aa AA seqDB search
MATYSTNEFRSGLKIMLDGEPCAILESEFVKPGKGQAFARVRLRKLISGKLLEKTFKSTD
SVESADVVDMNLTYLYNDGEFWHFMNNETFEQLAADEKSVGDSTKWLIDQAECILTLWDG
RPISVTPPNFVELEIIETDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRS
GEYVSRVK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggctacttatagtaccaacgaattccgttcaggtcttaaaatcatgttagatggcgag
ccgtgcgctattctagaaagcgaatttgttaaaccaggtaaaggacaggcatttgcccgt
gtgcgtcttcgtaaattgatctctggcaaactgctagagaaaaccttcaaatcaacggat
tccgttgaaagtgccgatgttgtggatatgaacctgacctatctatataacgatggtgag
ttctggcacttcatgaacaatgagacttttgaacagttggctgcggatgaaaaatctgtc
ggtgacagcacaaagtggctgatcgatcaggctgaatgcattctgaccctgtgggatgga
cgtcctatttctgtgactccgccaaactttgttgaactggaaattattgagacagatccc
ggtctgaaaggggatactgcaggcactggtggtaaaccagcaacccttagcacgggcgct
gtcgtgaaagttcctctgttcgtacagattggtgaagtcattaaagttgatacccgttcc
ggcgaatacgtttctcgcgtgaaataa

DBGET integrated database retrieval system