KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3570Help
Entry
XBJ1_3570         CDS       T01186                                 

Gene name
groL
Definition
(GenBank) chaperone Hsp60 (GroEL), part of GroE chaperone system
  KO
K04077  chaperonin GroEL
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    XBJ1_3570 (groL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:xbo03019]
    XBJ1_3570 (groL)
   03110 Chaperones and folding catalysts [BR:xbo03110]
    XBJ1_3570 (groL)
   03029 Mitochondrial biogenesis [BR:xbo03029]
    XBJ1_3570 (groL)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xbo04147]
    XBJ1_3570 (groL)
Messenger RNA biogenesis [BR:xbo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     XBJ1_3570 (groL)
Chaperones and folding catalysts [BR:xbo03110]
 Heat shock proteins
  HSP60 / Chaperonin
   XBJ1_3570 (groL)
Mitochondrial biogenesis [BR:xbo03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    XBJ1_3570 (groL)
Exosome [BR:xbo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   XBJ1_3570 (groL)
  Exosomal proteins of other body fluids (saliva and urine)
   XBJ1_3570 (groL)
  Exosomal proteins of breast cancer cells
   XBJ1_3570 (groL)
  Exosomal proteins of colorectal cancer cells
   XBJ1_3570 (groL)
  Exosomal proteins of bladder cancer cells
   XBJ1_3570 (groL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cpn60_TCP1 REF
Motif
Other DBs
NCBI-ProteinID: CBJ82688
UniProt: D3V4V9
Position
complement(3475674..3477320)
Genome map
AA seq 548 aa AA seqDB search
MAAKDVKFGNDARGKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGSPVITKDGVSVAREI
ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIVTEGLKAVAAGMNPMDLKRGI
DKAVIAAVEELKKLSVPCSDSTAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEEG
TGLEDELDVVEGMQFDRGYLSPYFINKPEAGSIELENPYILLVDKKISNIRELLPVLEGV
AKASKPLVIIAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIATLTNGTV
ISEEIGLELEKATLEDLGQAKRIVINKDTTIIIDGVGEAAAIAARVTQIRQQIEESTSDY
DREKLQERVAKLAGGVAVIKVGAATEVEMKEKRARVDDALHATRAAVEEGVVAGGGVALV
RAAAAISALTGDNEDQNVGIRVALRAMEAPMRQIVENAGEEPSVVVNNVKASQGNHGYNA
ATEEYGDMIEMGILDPTKVTRSALQFAGSIAGLMITTEAMITDLPRDDKADLGGAGGMGG
MGGMGGMM
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggcagctaaagacgtaaaatttggtaatgatgctcgcggcaaaatgctgcgtggtgtg
aatgtactggctgatgcagttaaagtgactctgggtcctaaaggccgtaacgttgtttta
gataaatcttttggttcgcctgtaatcactaaagacggcgtatctgtagcgcgtgaaatc
gaattagaagataaattcgagaacatgggtgcacagatggttaaagaagttgcctctaaa
gccaacgatgcggcaggcgacggtactaccactgctactgtactggcacagtctatcgtc
actgaaggtctgaaagccgttgctgctggcatgaacccgatggatctgaaacgcggtatc
gataaagcagttattgcggctgttgaagaactgaaaaaactgtccgtaccttgctctgac
tccactgccattgcgcaggttggtacaatttctgccaattccgacgaaaccgtaggtaaa
ttgatcgctgaagcgatggataaagtcggtaaagaaggtgtaatcaccgttgaagaaggt
actggtctggaagatgaactggatgttgttgaaggtatgcagttcgatcgcggctacctg
tctccttatttcatcaataaaccagaagcaggttctatcgagctggaaaacccatacatc
ctgctggttgacaagaaaatttctaacatccgtgaactgttgccagttctggaaggtgta
gccaaggcaagtaagccgctggttatcatcgctgaagacgttgaaggcgaagcgctggca
acgctggttgtcaacaacatgcgtggtatcgtgaaagtggctgcggttaaagcccctggt
tttggtgatcgccgtaaagcaatgttgcaggatatcgctactctgaccaacggtactgtg
atttctgaagagatcggtctggagctggaaaaagcgactctggaagatctgggtcaggca
aaacgcattgttatcaataaagacactacaattatcattgatggcgtaggcgaagcggcc
gcaattgctgcacgagttactcaaatccgtcagcaaatcgaagaatcaacttctgattat
gaccgtgaaaaactgcaggagcgcgtagcgaaactggcaggcggtgtggcagtgatcaaa
gtcggtgctgcaactgaagttgaaatgaaagaaaaacgcgctcgtgttgacgatgctctg
catgcgacccgcgcagcagtagaagaaggtgttgttgctggtggtggtgttgcactggtt
cgcgctgctgctgctatctctgctctgacgggcgacaacgaagatcaaaacgtgggtatc
cgcgttgctctgcgtgcaatggaagcgccaatgcgtcagatcgtagaaaacgcaggtgaa
gagccatctgtggttgtgaacaacgtgaaagcaagccagggtaaccacggttataacgct
gcaactgaagagtacggcgatatgatcgagatgggtattctggacccaactaaagtcact
cgctctgcactgcaattcgcaggctctatcgctggtctgatgatcacgactgaagcgatg
attaccgatctgcctagagacgacaaagctgacttaggtggagctggtggcatgggcggt
atgggtggaatgggcggcatgatgtag

DBGET integrated database retrieval system