KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3572Help
Entry
XBJ1_3572         CDS       T01186                                 

Gene name
fxsA
Definition
(GenBank) suppress F exclusion of bacteriophage T7
  KO
K07113  UPF0716 protein FxsA
Organism
xbo  Xenorhabdus bovienii SS-2004
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    XBJ1_3572 (fxsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FxsA
Motif
Other DBs
NCBI-ProteinID: CBJ82690
UniProt: D3V4W1
Position
complement(3477847..3478353)
Genome map
AA seq 168 aa AA seqDB search
MRWLPFVLICLLVYIESVLFVRIASEAGVLLTLLLVIFTSCVGVSLVRNQGIKNFMSMQQ
KIAAGESPAKEAIKSVSLVIAGVLLILPGFFTDFLGLLLLLPPAQKLLTAKLLPHITFYR
PNNHGQDGQGGHHGQTFEGEYERRQDDASYTLDGQKRHDEHGNEHDKK
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
gtgcgttggctcccatttgtcctgatatgtttgctggtttacatcgaatcagtcttattt
gttcgcattgcctctgaagccggagtcttactgactctgctgctagtcatttttacttct
tgtgttggtgtttcccttgtacgtaatcagggcatcaaaaattttatgtcgatgcagcaa
aaaattgctgctggcgaaagccctgcgaaagaggctatcaaaagtgtttctctggtgatt
gcgggagttctgctaatattgcccgggttttttactgactttctcggattgctgttgtta
ttgccacccgcgcagaagctgctgacagcaaaattgctgcctcatatcaccttttaccgt
ccgaataatcatgggcaagatggtcagggcggccatcatgggcagacttttgagggcgag
tatgagcgtaggcaggatgatgcttcctatacactggatggtcagaaacgtcacgatgaa
catggcaacgagcacgacaaaaagtaa

DBGET integrated database retrieval system