KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3578Help
Entry
XBJ1_3578         CDS       T01186                                 

Definition
(GenBank) hypothetical protein
Organism
xbo  Xenorhabdus bovienii SS-2004
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CBJ82696
UniProt: D3V4W7
Position
complement(3481490..3481717)
Genome map
AA seq 75 aa AA seqDB search
MERNEPHPGRKRYLITDNRCDSSVDLIDYIKARKPSSGKLRPEKLKSEKPFPSLSSAISC
GKAVVGKNRTVGYQD
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcaatgaacctcatcccgggcgaaaacgttatcttatcactgataatcggtgt
gattcatctgtggatttgattgattacattaaagccagaaaaccaagttcgggcaaacta
aggccagaaaaattaaagtcagaaaaaccgttcccaagcctgtcatctgctatctcatgt
ggcaaggccgtagtagggaagaataggacggtaggttatcaggattga

DBGET integrated database retrieval system