KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3582Help
Entry
XBJ1_3582         CDS       T01186                                 

Gene name
nlpD
Definition
(GenBank) lipoprotein
  KO
K06194  lipoprotein NlpD
Organism
xbo  Xenorhabdus bovienii SS-2004
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    XBJ1_3582 (nlpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M23 LysM
Motif
Other DBs
NCBI-ProteinID: CBJ82700
UniProt: D3V4X1
Position
complement(3485578..3486588)
Genome map
AA seq 336 aa AA seqDB search
MGVVLAGCSNTSDRPAPIVSIDKQEQNRGIPSRTSSISTPMPSSPSTISANRSSEHRASE
NRYLVNRAVENGSHQGRIIYNRNYGNIPKGSYSGSTYTVKSGDTLFYVAWITGIDFRDLS
HINNISEPYNLNVGQVLRMGNVNSSNGVLLASNSTQSKIEQVDFQKSNAYPANIDRQSSE
KMLPRKTISVSESSAMKLSSATDISPGSTISSGSSSWGWPAEGKVFEGFSDSKGGNKGID
IAGSRGQPVFATASGKVVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVRDSQDVQAG
QKIATMGSTGTSLVKLHFEIRYKGKSVNPLRHLPQR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgggagtggtactggcaggctgtagcaatacatcggatcgtccagcgccgatagtgagt
attgataagcaggaacaaaatagaggaatcccttccagaacctcgtccatctcgacaccc
atgccatcttctccttcaactatttcagcaaatcgttcatcagagcatcgtgcttcggaa
aatcgttatttagtgaatcgtgctgttgaaaatggctcacatcagggacggatcatctat
aaccgcaattatgggaatattcctaaaggaagctatagcggcagcacctacacggttaaa
agtggcgatactttgttctatgttgcatggattacaggcattgattttcgtgatctatct
cacataaataacatttcagagccttataacctcaatgttggccaagtcctgagaatgggt
aatgtaaactccagtaatggtgtattactagcatcaaatagtacccaatctaaaattgag
caggttgattttcaaaaaagtaatgcgtatcctgcaaacattgatagacagagttccgaa
aagatgttgccaagaaaaacaatttctgttagcgaaagttcagctatgaaattatcatcg
gcaacagatataagtcctggcagcaccatcagcagtggtagcagtagttggggatggcct
gcggaagggaaagtgtttgaaggtttttcggattctaagggtggaaataaaggcattgat
attgcgggtagtcgtggccagcccgtttttgcaactgccagtggaaaagtagtttatgcc
ggaaacgcattacgtggatatggaaatctcataattataaaacataacgatgactacctg
agtgcctatgctcacaacgataccatgctggttcgtgattcgcaggatgttcaggcgggg
caaaaaattgccactatgggtagtactggaacaagtttagtcaaattacattttgaaatt
cgttacaagggaaaatccgtaaacccgctgcgtcatcttccgcagcgataa

DBGET integrated database retrieval system