KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3584Help
Entry
XBJ1_3584         CDS       T01186                                 

Gene name
surE
Definition
(GenBank) survival protein, protein damage control
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo00230  Purine metabolism
xbo00240  Pyrimidine metabolism
xbo00760  Nicotinate and nicotinamide metabolism
xbo01100  Metabolic pathways
xbo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    XBJ1_3584 (surE)
   00240 Pyrimidine metabolism
    XBJ1_3584 (surE)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    XBJ1_3584 (surE)
Enzymes [BR:xbo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     XBJ1_3584 (surE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: CBJ82702
UniProt: D3V4X3
Position
complement(3487408..3488172)
Genome map
AA seq 254 aa AA seqDB search
MLRILLSNDDGVTAPGIQTLAARLREHYHVQVVAPDRNRSGASNALTLDRPLRINTMNNG
DIAVQEGTPTDCVYLGVNRLVLPRPDIVVSGINCGPNLGDDVIYSGTVAAAMEGRHLGLP
ALAVSLNGDRHYETAAEVTMRLLNLLQKSPLRAGNILNINVPDVPIEQIKGFRVTRCGSR
CAAKEVYALEDPKGNMLYWIGPPGEKHDAGPETDFAAIEDGFVSITPLQVDLTAYKAQEL
INDWLVKVGDMGEC
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggatattgctgagtaacgatgatggtgttaccgcaccgggtattcaaacctta
gcggccagattgcgggaacactatcatgttcaggtggtcgcacctgatcgtaaccgcagc
ggagcatcgaatgcgttaacgctggatcgtcccttgcgtatcaatacgatgaataatggt
gatattgccgttcaggaaggtacgccgacggattgtgtctatctgggcgttaatcgcctg
gttcttcctcgcccggatattgtggtttcaggaatcaactgtggtcccaaccttggtgat
gatgtgatttattccggcacagtggcggccgcgatggaaggacgccatttaggattaccg
gcgctggcggtatcactcaatggtgacagacattatgaaacagccgcagaagttacgatg
cgcctattaaacctgttgcaaaaatctcccttaagggccggcaatattctgaacatcaat
gtgcctgacgtccctattgagcagatcaaaggttttcgggtaacacgatgcggcagtcga
tgtgctgctaaagaagtttacgctttggaagatcccaaaggtaacatgctttactggata
gggcctcctggcgagaaacatgacgcagggccagaaacagactttgcagcgatagaagac
gggtttgtctccattactcctttacaggtggacttaaccgcttataaggcacaggagtta
atcaacgattggttggtaaaagtcggagatatgggagaatgctga

DBGET integrated database retrieval system