KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3587Help
Entry
XBJ1_3587         CDS       T01186                                 

Definition
(GenBank) hypothetical protein
Organism
xbo  Xenorhabdus bovienii SS-2004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_3
Motif
Other DBs
NCBI-ProteinID: CBJ82705
UniProt: D3V4X6
Position
complement(3488599..3488820)
Genome map
AA seq 73 aa AA seqDB search
MDNAPFHKRNDTTQAIADSRCQLEWLPAYSPDLNPIEHKWGGAKAIRRQKDVQLMSCLRS
ILNRSGYVDSAIS
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atggataatgcgcctttccataaacggaatgacacgacacaagcgatagcagacagcaga
tgtcaactggaatggcttcccgcttatagtccggatttaaaccctatagaacacaaatgg
ggcggagcaaaagcgataaggaggcaaaaagatgttcagttgatgagttgtttacggagc
atattgaataggtcaggttatgttgattctgctatatcttaa

DBGET integrated database retrieval system