KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3590Help
Entry
XBJ1_3590         CDS       T01186                                 

Definition
(GenBank) hypothetical protein
Organism
xbo  Xenorhabdus bovienii SS-2004
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CBJ82708
UniProt: D3V4X9
Position
3489722..3489856
Genome map
AA seq 44 aa AA seqDB search
MGDNINRIVQAFERFSDKEHRSGLAQKQGSLPDDRLMRQNPVSA
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
ctgggcgataatatcaacaggatagtgcaggcgtttgaacgcttttcggataaggaacat
cgctctggactcgctcaaaaacaggggagcttacctgatgaccgcttaatgcgacagaac
ccagtttctgcataa

DBGET integrated database retrieval system