KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3591Help
Entry
XBJ1_3591         CDS       T01186                                 

Definition
(GenBank) hypothetical protein
Organism
xbo  Xenorhabdus bovienii SS-2004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4519
Motif
Other DBs
NCBI-ProteinID: CBJ82709
UniProt: D3V4Y0
Position
3490271..3490672
Genome map
AA seq 133 aa AA seqDB search
MEVEKFNFYYNTNATSIRQKENFEGWIRRYELDFKIISKMKINFDIDTLKIKIISISIPF
LFLFFMYLCIYVFMYLCFISAMPVALKPAGLIKINDDDGWFWINKNEAMEYGFLNKRKDL
WVVTPEMGHVLND
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggaagtggaaaagtttaatttttactacaatacaaacgcaacatcaataagacagaag
gaaaattttgaaggctggataagaagatatgaattggattttaaaattatctctaaaatg
aaaataaactttgacattgatacgcttaaaataaaaataatatcaatctcaattccattt
ctgtttttattttttatgtatttatgtatttatgtatttatgtatttatgctttatatca
gcaatgcctgtggctttaaagcctgcaggcttgataaagataaatgatgatgacgggtgg
ttttggattaataaaaatgaagctatggaatatggttttttaaataaacgaaaagactta
tgggttgttactccagaaatgggtcatgtattaaatgattag

DBGET integrated database retrieval system