KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3606Help
Entry
XBJ1_3606         CDS       T01186                                 

Gene name
cysC
Definition
(GenBank) adenosine 5'-phosphosulfate kinase
  KO
K00860  adenylylsulfate kinase [EC:2.7.1.25]
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo00230  Purine metabolism
xbo00920  Sulfur metabolism
xbo01100  Metabolic pathways
xbo01120  Microbial metabolism in diverse environments
Module
xbo_M00176  Assimilatory sulfate reduction, sulfate => H2S
xbo_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    XBJ1_3606 (cysC)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    XBJ1_3606 (cysC)
Enzymes [BR:xbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.25  adenylyl-sulfate kinase
     XBJ1_3606 (cysC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APS_kinase AAA_33 AAA_18 CbiA KTI12 AAA_29 AAA_16 ArgK DUF815 SRP54 IstB_IS21 Zeta_toxin AAA_23 Torsin AAA_30 RNA_helicase AAA_17 ParA ABC_tran ATP_bind_1 AAA_28 NACHT RsgA_GTPase PRK
Motif
Other DBs
NCBI-ProteinID: CBJ82724
UniProt: D3V4Z5
Position
complement(3498789..3499406)
Genome map
AA seq 205 aa AA seqDB search
MSQIKEHSFSNVVWHSHTLDRKQREVVNGHPALVIWFTGLSGSGKSTLAGALEQALFSRG
IKTYLLDGDNLRHGLCSDLGFSETERRENIRRIGEVSKLMVDAGLVVLTAFISPHRAERQ
KLRELMGADRFIEVFVDTPLAICEARDPKGLYKKARAGELLNFTGIDSAYETPEQPDIYL
DGSLPVESSIEKLLAALHNHNFLPI
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgtctcagatcaaggaacactcgttttctaatgtcgtttggcattcacatacgttggac
agaaagcaaagggaagtggtgaatggccatcctgctttagtcatctggttcactgggttg
tctggctcagggaaatccacacttgcaggcgcactggaacaagccctgttttcgcggggg
atcaaaacctatttattggatggagataatctgcgtcatggcttgtgcagcgatttggga
ttttctgaaactgaacgacgagagaatatccggcgtatcggagaagtctcaaaattgatg
gttgatgctgggctagtagtcttaacggcgtttatttctccccatagagctgaacggcaa
aaactacgtgaattgatgggagccgatcgatttattgaagtctttgtggatacgccgctg
gcgatatgtgaagcccgtgatccgaaaggcttgtataaaaaagcgcgggcgggggagctg
cttaacttcacgggaattgattcagcttacgagacgccagaacagcccgacatctatttg
gatggctcactacctgttgaatcatcgatagaaaaattgcttgctgcgctgcataaccac
aactttttgcctatttga

DBGET integrated database retrieval system