KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3608Help
Entry
XBJ1_3608         CDS       T01186                                 

Gene name
cysD
Definition
(GenBank) ATP-sulfurylase, subunit 2 (ATP:sulfate adenylyltransferase)
  KO
K00957  sulfate adenylyltransferase subunit 2 [EC:2.7.7.4]
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo00230  Purine metabolism
xbo00261  Monobactam biosynthesis
xbo00450  Selenocompound metabolism
xbo00920  Sulfur metabolism
xbo01100  Metabolic pathways
xbo01120  Microbial metabolism in diverse environments
xbo01130  Biosynthesis of antibiotics
Module
xbo_M00176  Assimilatory sulfate reduction, sulfate => H2S
xbo_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    XBJ1_3608 (cysD)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    XBJ1_3608 (cysD)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    XBJ1_3608 (cysD)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    XBJ1_3608 (cysD)
Enzymes [BR:xbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     XBJ1_3608 (cysD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAPS_reduct
Motif
Other DBs
NCBI-ProteinID: CBJ82726
UniProt: D3V4Z7
Position
complement(3500861..3501769)
Genome map
AA seq 302 aa AA seqDB search
MDEKKLTHLQQLEAESIHIIREVAAEFANPVMLYSIGKDSSVMLHLARKAFYPGKLPFSL
LHVDTGWKFREMYDFRDHTAEKYGFELLVYRNPQGEALGINPFIHGSAKHTDIMKTEGLK
QALDKYRFDAAFGGARRDEEKSRAKERIYSFRDRSHRWDPKNQRPELWRNYNGQINKGES
IRVFPLSNWTELDIWQYIYLEQIDIVPLYFAKHRPVIQRDGALIMVDDARIDLKSGEVIS
QRKVRFRTLGCWPLTGAVESEAETLPEIIEEMLISTTSERQGRLIDSDQSGSMELKKRQG
YF
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggacgaaaaaaaactgacacacttgcagcaactcgaagctgaaagcattcatattatt
cgcgaagtggctgccgaatttgctaatcccgtaatgctttattccattggtaaagattcc
tcggtgatgctgcatctcgcccgcaaggcgttctatccgggaaaattgcctttttcctta
ctgcacgttgatacaggatggaaattccgtgaaatgtatgacttccgtgatcatacagcg
gaaaaatacggttttgaattactggtttaccgtaacccacaaggtgaagcactgggtatt
aacccctttatccatggcagtgcaaaacacaccgacatcatgaaaacggaagggctgaaa
caggctctggataaataccgatttgatgcagcatttggtggggcaaggcgtgatgaagaa
aaatcccgggccaaagagcgcatctactcattccgtgatcgttcccatcgttgggatccc
aaaaaccagcgtccagaactctggcgtaactataacggtcagatcaacaaaggggaaagc
atccgtgtattcccgttatccaactggactgaattggatatctggcaatacatctatctg
gagcagatagacattgtccctctttacttcgccaaacaccgtccggtcattcagcgtgat
ggtgcattgattatggttgacgacgctcgtattgatctgaaatcaggtgaagtcatcagc
caaagaaaagttcgcttcagaacactgggctgctggccactgactggcgctgtggaatca
gaagccgaaacgctgccggaaatcatagaagaaatgttgatatcgaccaccagtgagcgg
cagggacggcttatcgacagtgatcagtccggctcgatggagttgaaaaaacgtcagggt
tatttttga

DBGET integrated database retrieval system