KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3614Help
Entry
XBJ1_3614         CDS       T01186                                 

Gene name
ygcF
Definition
(GenBank) putative coenzyme PQQ synthesis protein with nitrogenase iron-molybdenum domain
  KO
K10026  7-carboxy-7-deazaguanine synthase [EC:4.3.99.3]
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo00790  Folate biosynthesis
xbo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XBJ1_3614 (ygcF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xbo03016]
    XBJ1_3614 (ygcF)
Enzymes [BR:xbo01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.99  Other carbon-nitrogen lyases
    4.3.99.3  7-carboxy-7-deazaguanine synthase
     XBJ1_3614 (ygcF)
Transfer RNA biogenesis [BR:xbo03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    XBJ1_3614 (ygcF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_14 Fer4_12 Radical_SAM
Motif
Other DBs
NCBI-ProteinID: CBJ82732
UniProt: D3V503
Position
complement(3508423..3509094)
Genome map
AA seq 223 aa AA seqDB search
MIYPINEIFQTLQGEGVFTGVPSVFIRLQGCPVGCSWCDTKHTWEKEADKQQPMENILVK
SQDSDTWGAATARQIINLFIRQGYTARHIVVTGGEPCLYNLRPLTETLESEGYQCQIETS
GTHAIQCSEKTWVTVSPKVKMRGGYQVLPEAMNRANEIKHPVGRERDIEALDELLTMLDE
KADPVIALQPISQKEEATRLCIETCIARNWRFSMQTHKYLNIA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgatttacccaataaatgaaatttttcaaactttgcagggagaaggtgtgtttaccggt
gtgccttcagttttcatccgcttacagggatgtccggtagggtgcagttggtgtgatacc
aaacatacgtgggaaaaagaggctgataaacaacagcctatggaaaacatcctcgtgaaa
tcgcaggatagtgatacatggggagcagccactgcaagacaaattattaacttattcatc
cgtcagggttatacggcgcgtcatatcgtcgttaccggaggtgaaccgtgcctgtataat
ctgcgtcccttgaccgaaacattggaaagtgaaggctatcagtgtcagatagaaaccagt
ggtacacatgcgatccagtgttctgaaaaaacgtgggtcacagtttcaccgaaagtaaaa
atgcgtggcggatatcaggtattacctgaagcgatgaaccgtgcaaatgaaatcaagcac
ccagtcgggcgggagcgcgatattgaagcattggatgaactgctgacgatgctcgatgaa
aaggcagatccggttattgccttacagcccatcagtcagaaagaagaagcaacccgcctg
tgtattgaaacttgtattgcccgtaactggcgtttttcgatgcagacacacaaatactta
aatatcgcctga

DBGET integrated database retrieval system