KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3615Help
Entry
XBJ1_3615         CDS       T01186                                 

Gene name
proY
Definition
(GenBank) proline transport protein (APC family)
  KO
K16234  histidine transporter
Organism
xbo  Xenorhabdus bovienii SS-2004
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xbo02000]
    XBJ1_3615 (proY)
Transporters [BR:xbo02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   XBJ1_3615 (proY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease AA_permease_2
Motif
Other DBs
NCBI-ProteinID: CBJ82733
UniProt: D3V504
Position
3509263..3510651
Genome map
AA seq 462 aa AA seqDB search
MQHNENQLKQGLSVRHIRFMALGSAIGTGLFYGSAAAIQHAGPAVLLAYLIGGAAVFMVM
RALGEMAVHHPVSGSFSQYASHYLGPLAGFLTGWIYVLEMLFVCLADITAFGMYMRLWFP
HVDQWIWVLGIVCFIGALNLCHVKIFGEMEFWLSIVKVTAIIAMIIGGIIIMIYGFGQST
EHATGISNLWEHGGFMPNGISGVVASFAIVMFAFGGIEVIGITASEAKNPEKTIPKAINA
VPFRILIFYVLTLCILMCIYPWNQIDQNASPFVQIFSNLGINSAANILNVVVITAAISAI
NSDIFGAGRMMYGMAQERQAPEAFKKLTRNGVPWMTVLVMTIVLLLGVWLNFLIPNDIFI
LIASVATFATVWVWLMILISHVAMRRQMSAKDIKSLKFPVPMWPIAPAITIVFMVGVIML
LGYFEQTRDALYVGIGWVLVLTLAYSFCVKKKLSKNHLSTNQ
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcaacataatgaaaatcagcttaaacagggtctgagcgtacggcatattcgctttatg
gctttaggctctgcaataggcactgggctgttttatggctcggcagcggcgattcagcat
gctggccctgctgtattgctggcctatttaatcggtggtgctgctgtatttatggtgatg
agagcacttggcgaaatggccgttcaccatcccgtttccggttctttttcacaatatgcc
agccattatctgggaccattggccggctttctgaccggttggatttatgttcttgaaatg
ctgtttgtttgtctggctgatatcaccgcattcggcatgtatatgaggctatggttccca
cacgtcgatcaatggatttgggtgctgggtattgtatgttttatcggtgccctaaatctg
tgccatgtaaaaatattcggtgaaatggagttctggctttcgatcgtcaaagttaccgcc
atcattgctatgattatcggcggcatcataattatgatctacggttttggtcaatcaact
gaacatgctaccggtatttccaatttatgggagcatggcggcttcatgccaaatggtatc
agtggggtggttgcctcattcgcaattgttatgttcgcttttggtggcatagaagtgatc
ggtattactgccagtgaagcgaaaaacccagaaaaaacgattcctaaagcaatcaatgcc
gttccattccgtattttgatcttctatgtcctgacgttgtgtattctaatgtgcatctat
ccatggaatcagattgatcagaatgcaagcccatttgtacagattttttccaatctggga
attaattcagcagcgaatattttaaatgtcgtcgtgattactgccgctatttcagccatc
aacagcgatatttttggtgcaggaaggatgatgtacggcatggctcaggaaagacaggct
cctgaagcattcaagaaactgacccgtaatggtgtaccgtggatgaccgtgcttgtcatg
actatagttctattacttggcgtatggctgaatttcttgatccctaatgatatttttatc
cttatcgcgtctgttgcaacatttgcaaccgtctgggtatggctgatgattttaatttct
cacgttgccatgcgccgtcaaatgagtgcaaaagacatcaagtcattgaaatttcccgtt
ccaatgtggccaattgcgcctgcaattacgatcgttttcatggtcggtgtcatcatgttg
ctcggctattttgagcaaacaagggatgctctgtatgttgggataggttgggtgttagtc
ctcacactggcttattctttctgtgtgaagaagaaattatcaaaaaatcatctttctact
aaccaataa

DBGET integrated database retrieval system