KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3697Help
Entry
XBJ1_3697         CDS       T01186                                 

Gene name
recC
Definition
(GenBank) exonuclease V, gamma chain with recB and recD: 5' and 3' nuclease, ATPase, recombinase, helicase
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    XBJ1_3697 (recC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:xbo03400]
    XBJ1_3697 (recC)
Enzymes [BR:xbo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     XBJ1_3697 (recC)
DNA repair and recombination proteins [BR:xbo03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     XBJ1_3697 (recC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C
Motif
Other DBs
NCBI-ProteinID: CBJ82815
UniProt: D3V586
Position
3593646..3597035
Genome map
AA seq 1129 aa AA seqDB search
MFRVYHSNQLDILKELMAIFIGENPLTNPFGKEVVLVQSPGMSQWLQIQLAEKLGVAANM
EFPLPATFIWQMFTQVLPDVPKDGSFSKDAMKWKLMTLLPGLLTEPDFSSLRHYLDQDID
KRKIHQLAGRVADLFDQYLVYRPQWLESWESDQSIDGLSDTQAWQKRLWLELTEYTRQLE
QPLWHRANLYHRFISTLQEGRFPLEKLPARVFICGISTLPPAYLQIFKALGQHIDIHLMF
TNPCLYYWGDIQSYAFLAKLNSRKPKHYQSQQSLERFRDPENASSLFNDEGEQSLNNPLL
ASWGKLGRDNLYLLSQLEPDSDVHAFVELEPSCILHQIQRDMLNLEDHAQIGSTEHSFKN
SLKKRQIDGKDRSLSFHSCHSPQREVEVLQDQILRLLDDDPSLTPRDIIVMMADIDSYTP
YIQAVFGNAPEERYIPFAISDRKARQAHPVLQAFITLLELPQSRFTAEQVLALLEVPALA
SKFAIQEDGLRLLRRWVKESGICWGLDDDNIEALSLPATGQNTWRFGLTRMLLGYAMDSH
AGPWNDVLPYDESSGLAAELAGQLAEFLMELNRWRKILSEDQRLSGWLAVCPQLLETFFD
ADEETELVLALITQQWQKVIDNGLNAHYSESVPLVLLRDELVLRFDDEKISQRFLAGSLN
FCTLMPMRSIPFKVVCLLGMNDGVYPRTIPPLGFDLMAEKSQRGDRKRRDDDRYLFLEAL
ISAETCLYISYIGKSIRDDTECNPSVLVSELLDYVCQSCCLPGDEMLNVDDSARKVRNHL
LLQHTRVPFAMENFVPDHYQQSYAAEWLPAASQQGASPIDFCQPVEFETSEIKEVALDEL
IRFYRYPVRAFFQRRLKVHFIIEETELPEEEPFVLDHLQRYQFNQLLLSILLEEGSPESL
FYHLRASGGLPHGAFGEVYWLNQLEAMQPLANKIREERTESSFIELHHELDTVVLTGKIH
QVQPDGILRWRPANLMANDGIQLWIEHLAYCFSGNNGESRMYGRENSEWRFSPLTSDEAK
KYLNQMVAGYFQGMSEPLPLFCRSGWAWLDDCFDRESQKINFSEEAQQKAENKLMQQWLG
TQGKSGESSDAYVQRAFRQVDQLFWVRMKREVQSYLLPMACHLSRSSSK
NT seq 3390 nt NT seq  +upstreamnt  +downstreamnt
atgtttagagtttatcattcaaatcaactcgatattcttaaggagttgatggcaatattt
atcggggaaaatccccttaccaacccatttggcaaagaagtggttctagtgcaaagcccc
ggcatgtcacagtggctgcaaatccaactggcagaaaaactgggagttgccgcgaacatg
gaatttccactgccggctacttttatctggcagatgtttacgcaggtattacctgatgtt
cctaaagatggctcattcagtaaggatgccatgaaatggaaattgatgacgctgttaccc
ggcttgttgacagagcctgatttttcatctctcaggcactatctcgaccaagatatcgat
aaacgtaagatccaccagctggcaggccgagttgccgatttgtttgaccaatatctggtt
tatcgcccccaatggctggaaagctgggaaagcgatcagtcaattgatggattaagtgat
acccaagcttggcaaaaaagattatggcttgaactgacagaatatactcgtcagctagaa
caaccactgtggcaccgcgctaacttatatcatagatttatttcaactttgcaagaaggt
cgttttccactggaaaagctgcctgcacgggtatttatctgtgggatatctacgttacct
cctgcttatctgcaaatatttaaggcattggggcaacatatcgatattcacctgatgttc
actaatccctgcctgtactattggggggatatccagagttatgcctttctggccaagtta
aatagccgtaaaccaaaacattatcaaagccagcagtcattggaacgatttagagatccg
gaaaatgcgtcatctcttttcaatgatgagggagagcagagcctgaacaatcccttgttg
gcgtcatgggggaaattaggcagggataacctctacctgctatcgcagttggaacctgac
tctgatgttcatgcttttgttgaactggagccgagttgtatcctgcatcaaatccagcgg
gatatgctgaatcttgaagatcacgctcaaattggctccacggaacactctttcaaaaat
agcctaaaaaaacgtcagattgatggtaaagaccgctcgctatcttttcattcatgtcat
agcccccagagagaggtggaagttttgcaggatcagatcctgcgtcttttggatgatgat
ccctcactgacaccacgagacattatcgtgatgatggcggatatcgacagttatactccc
tatattcaggcggttttcggcaatgcaccggaggagcgctatatcccctttgcgatttct
gatcgtaaagcccgtcaggctcaccccgttttgcaggcttttattaccttactagagctg
ccgcagagtcgttttacggcggagcaggtactggcattactggaagtgcctgcattggcc
agcaaatttgccattcaggaagacggattgcgtctgttacgacgctgggtgaaagaatca
gggatttgctgggggttggatgacgacaacatagaagcactgtcgttgcctgctaccgga
cagaacacgtggcgttttggtttaacacgtatgctattggggtatgctatggacagccat
gcaggcccatggaatgacgttttgccttatgatgaatccagtggtcttgccgcagaactg
gcgggacaactggcggaatttttaatggagctgaaccgctggcgtaaaattctgagtgaa
gatcagaggctgtcgggttggctggcagtatgtccgcagctgttggaaactttctttgat
gcggatgaggaaacagaactggtattggcattgatcactcagcagtggcagaaagtcatt
gataatggtctgaatgctcattacagcgagagtgtccctttggtgctgttgcgtgatgaa
ttggtgctgcgttttgatgatgagaagatcagtcagcgttttctcgctggttcgttgaac
ttctgtactcttatgcccatgcgttccattccttttaaagttgtctgcctgctgggaatg
aatgatggcgtttatccacgaactattccgccactcgggttcgatctgatggcagaaaaa
agccagcggggagataggaagcgtcgcgatgatgaccgttatctttttctggaagccctg
atttcggcagaaacgtgcctttatattagttatatcggtaaatcaattcgtgatgataca
gagtgtaatccttctgtactggtcagtgagttactggattatgtctgccagagctgttgc
ttgccgggagatgagatgctgaatgttgatgacagcgcaagaaaagttagaaatcacctg
ctgttacagcatactcgtgttccttttgcgatggaaaacttcgtgcctgatcattatcag
caaagttatgccgcagaatggttgccggcagccagtcagcaaggtgcttcccccatcgat
ttttgccagccggttgagtttgagaccagtgagataaaggaagtggcactcgatgaactg
atccgtttttaccgttaccccgtcagggcattttttcagcgtcggctgaaagtgcatttc
atcattgaagagacggaactgcctgaagaagaacctttcgtactcgatcatctgcaacgt
tatcaatttaaccaattgttgttgagtatcttgctagaagaaggatcacctgaatctctg
ttttatcatctccgcgcatcgggaggtttgccacatggggcgtttggtgaggtttactgg
ctgaatcaattagaagctatgcagccactggcaaataagattcgggaagagagaacggag
tcttctttcatagagttacaccatgagttagatactgtggtattgactggaaaaatccat
caggtgcagcccgatggaattttacgttggcgtccagcgaacttaatggctaatgatggt
atccaactatggattgaacatcttgcctattgtttttcaggcaacaatggtgagagccga
atgtatggaagggaaaacagcgagtggcgtttttcaccattgacatcggatgaggcaaaa
aaatacctgaatcagatggttgctggttattttcagggcatgtctgaaccactccctttg
ttttgccgaagcggttgggcatggctggatgattgctttgacagagagagccagaaaatc
aatttcagtgaggaagctcagcaaaaagctgaaaacaaactgatgcagcaatggctggga
acacagggaaaaagtggagaaagcagtgatgcttacgtccaacgagcatttaggcaagtt
gatcaattattttgggtgcgtatgaaacgcgaagtacagagttatttgttgcctatggct
tgtcatttaagtcgttcttcatctaaataa

DBGET integrated database retrieval system