KEGG   Xanthomonas campestris pv. campestris B100: xcc-b100_0215Help
Entry
xcc-b100_0215     CDS       T00759                                 

Gene name
fadA1
Definition
(GenBank) acetyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
xca00071  Fatty acid degradation
xca00072  Synthesis and degradation of ketone bodies
xca00280  Valine, leucine and isoleucine degradation
xca00310  Lysine degradation
xca00362  Benzoate degradation
xca00380  Tryptophan metabolism
xca00620  Pyruvate metabolism
xca00630  Glyoxylate and dicarboxylate metabolism
xca00640  Propanoate metabolism
xca00650  Butanoate metabolism
xca00900  Terpenoid backbone biosynthesis
xca01100  Metabolic pathways
xca01110  Biosynthesis of secondary metabolites
xca01120  Microbial metabolism in diverse environments
xca01130  Biosynthesis of antibiotics
xca01200  Carbon metabolism
xca01212  Fatty acid metabolism
xca02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    xcc-b100_0215 (fadA1)
   00630 Glyoxylate and dicarboxylate metabolism
    xcc-b100_0215 (fadA1)
   00640 Propanoate metabolism
    xcc-b100_0215 (fadA1)
   00650 Butanoate metabolism
    xcc-b100_0215 (fadA1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    xcc-b100_0215 (fadA1)
   00072 Synthesis and degradation of ketone bodies
    xcc-b100_0215 (fadA1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    xcc-b100_0215 (fadA1)
   00310 Lysine degradation
    xcc-b100_0215 (fadA1)
   00380 Tryptophan metabolism
    xcc-b100_0215 (fadA1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    xcc-b100_0215 (fadA1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    xcc-b100_0215 (fadA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    xcc-b100_0215 (fadA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xca04147]
    xcc-b100_0215 (fadA1)
Enzymes [BR:xca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     xcc-b100_0215 (fadA1)
Exosome [BR:xca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   xcc-b100_0215 (fadA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAP49546
UniProt: B0RLV9
Position
248433..249728
Genome map
AA seq 431 aa AA seqDB search
MQGQPMPAARPVAILGGVRIPFCRQNTAYADVGNLGMSVRTLGALVERFGLHGQQLGEVA
MGAVIKHSSDWNLAREAALSSGLSPLTPGITLQRACGTSLDSVITIANKIALGQIDSGIG
GGSDTTSEVPIVYGKKLRARLLAANRAKATGDKLKALLRGFKLGELKPEFPGVAEPRTGK
SMGEHCEDMAKEWNISRDSQDEWAVASHHKLAAAYERGFFDALIAPFRGVSRDNILRADT
SLEKLATLRPAFDKTSGRGTLTAANSTPLTDGAAAVLLSSEAWALAHGHTPMAYLRDAQV
SAVDFVHGEGLLMAPTVAVPQMLARHGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCR
NRLGLDAPLGRIDPDKINPLGSSLATGHPFAATGARVVATAAKQLEERGGGRALISICTA
GGMGVVAIVER
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggtcagccgatgcccgcagcccgtcccgtcgccatcctgggcggcgttcgtatc
ccgttctgtcgccagaacaccgcatacgcggacgtgggcaacctgggcatgtcggtgcgc
acgctgggcgcgctggtcgaacgcttcgggctgcatggccagcaactgggcgaggtggcg
atgggggcggtgatcaagcattcctccgactggaacctggcccgcgaagccgcgctgtcg
tcgggcctgtcgccgctcacgccgggcatcaccctgcagcgcgcctgtggcaccagcctg
gattcggtgatcaccatcgccaacaagatcgcgctggggcagatcgattcgggcatcggc
ggcggctcggacaccacctccgaggtgccgatcgtctacggcaagaagctgcgggcgcgc
ctgctggccgccaaccgcgcgaaggcgaccggcgacaagctcaaggcgctgctgcgcggt
ttcaagctgggcgagctcaagccagagttccccggcgtggccgagccgcgcaccggcaag
agcatgggcgaacactgcgaagacatggccaaggaatggaacatctcgcgtgattcgcag
gacgaatgggcagtggcctcgcaccacaagttggcggccgcgtatgagcgcgggtttttc
gatgcgctgattgctccgttccgtggcgtgtcgcgcgacaacatcctgcgcgcggacacc
tcgctggaaaagctggccacgttgcgcccggcgttcgacaagacctccggccgcggcacg
ctcactgccgccaattccaccccgctcaccgatggcgccgccgcggtgctgttgtccagc
gaagcctgggcgctggcccatggccacacgccgatggcctacctgcgcgatgcacaggtc
tcggcggtggatttcgtgcatggcgagggcctgctgatggcgcccacggttgcggtgccg
cagatgctggcccggcacgggctgaccttgcaggacttcgacatctacgagatccacgaa
gccttcgccgcgcaggtgctgtgcacgctgcgcgcctgggagagcgaggattactgccgc
aatcgcctggggctggacgcgccgctgggccgcatcgacccggacaagatcaacccgctg
ggctcctcgctggccaccggccacccgtttgccgcgaccggcgcacgcgtcgtggctacc
gcagccaagcagctggaagaacgcggcggcggacgtgccctgatttcgatctgcaccgcc
ggcggcatgggcgtggtggcgatcgtggaacgctga

DBGET integrated database retrieval system