KEGG   Xanthomonas campestris pv. campestris B100: xcc-b100_1179
Entry
xcc-b100_1179     CDS       T00759                                 

Definition
(GenBank) TolB protein
  KO
K03641  TolB protein
Organism
xca  Xanthomonas campestris pv. campestris B100
Brite
KEGG Orthology (KO) [BR:xca00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xca02000]
    xcc-b100_1179
Transporters [BR:xca02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   xcc-b100_1179
SSDB
Motif
Pfam: PD40 TolB_N DPPIV_N Pectate_lyase22 Peptidase_S9_N SGL
Other DBs
NCBI-ProteinID: CAP50527
UniProt: B0RPZ2
Position
1359735..1361054
AA seq 439 aa
MKKPLRWLAALTALLLPLSAFAQQQGLTIDIVGGSASATPITVVPMPYQGSGTAPQTDVS
AVVSADLDRSGQFRTLPAAQIVEKPTRGTEVQFQTWRTLKQNYIVVGRVMDAGEGAYRVE
YELFDVAKGERLLGLAMTARANAMRDVSHQMADAIYEKVTGVRGAFWTRIAYVTASGSGG
SMRYALMVADSDGYNPQTIVRSAEPLLSPNWSPDGKKLAYVSFERGNSSIYLQDIASGAR
ELVSSFRGINGAPSFSPDGRRLALALSRSGNPEIYVMDLGSKQLTQLTNHFGIDTEPTWA
PDGGSIYFTSDRGGRPQIYQVAASGGSANRVTFQGNYNATASVSFDGKKVAVAQGSGNTY
RIAMMDRSLGSPSWSTLSPGSLDESPSFAPNASMVLYAAREGGRGVLYAVSADARVRQRL
VLADGDVREPAWGPYRTAH
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgaagaaaccgctgcgttggttagctgccttgaccgccctgttgctgccgctgagcgcg
ttcgcgcaacagcaagggctcactattgatattgtcggcggcagcgcctcggccacgccg
atcactgtcgttcccatgccgtaccagggctccggtaccgcgccgcagaccgacgtttcc
gccgtggtcagtgccgacctggaccgttccggtcagttccgcaccctgccggccgcgcag
atcgttgaaaagccgacccgcggcaccgaggtgcagttccagacctggcgcacgctcaag
cagaactacatcgtggtcggccgcgtgatggacgccggtgagggcgcctatcgcgtcgaa
tacgagctgttcgacgtcgccaagggcgagcgcctgctgggcctggcaatgaccgcgcgc
gccaatgcgatgcgcgatgtctcgcaccagatggccgacgccatctatgaaaaagtcacc
ggcgtgcgtggcgcgttctggacccgtatcgcttacgtgaccgccagcggcagcggcggc
tcgatgcgctatgcgctgatggtggccgactccgatggctacaacccgcagaccatcgtg
cgttcggccgagccattgctgtcgccgaactggagcccggacggcaagaagctggcctat
gtgagcttcgagcgcggcaattcctcgatctacctgcaggacatcgccagcggcgcacgc
gaactggtttccagcttccgtggcatcaacggcgcgccctcgttctcgccggatggccgt
cgcttggcgctggccctgtcgcgcagcggcaacccggagatctacgtgatggacctgggc
agcaagcagctgacccagctgaccaaccacttcggcatcgataccgagccgacctgggca
ccggacggcggcagcatttatttcacctccgaccgtggtggccgcccgcagatctatcag
gtcgcagccagtggcggcagcgccaaccgcgtgaccttccagggcaactacaacgctacc
gccagtgtctcgttcgacggcaagaaggtcgccgtggcacagggcagcggcaatacctat
cgcatcgccatgatggatcgcagcctgggttcgcccagctggagcacgttgtcgccgggt
tcgctggacgaatccccgagcttcgcgccgaatgccagcatggtgctgtacgccgcacgt
gagggtggccggggcgtcctgtacgccgtgtctgccgacgcacgggtccgccagcgcctg
gttctggccgacggtgatgtaagagaacccgcatgggggccttaccgaaccgcgcattaa

DBGET integrated database retrieval system