KEGG   Xanthomonas campestris pv. campestris B100: xcc-b100_2958Help
Entry
xcc-b100_2958     CDS       T00759                                 

Definition
(GenBank) unnamed protein product
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
xca00450  Selenocompound metabolism
xca00970  Aminoacyl-tRNA biosynthesis
xca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xca00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    xcc-b100_2958
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    xcc-b100_2958
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xca01007]
    xcc-b100_2958
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xca03016]
    xcc-b100_2958
Enzymes [BR:xca01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     xcc-b100_2958
Amino acid related enzymes [BR:xca01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   xcc-b100_2958
Transfer RNA biogenesis [BR:xca03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    xcc-b100_2958
 Prokaryotic type
   Other AARSs
    xcc-b100_2958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: CAP52319
UniProt: B0RWA1
Position
3390184..3392268
Genome map
AA seq 694 aa AA seqDB search
MTRTALVTTALPYANGPLHLGHLVGYIQADIWVRARRLRGDKTWFVCADDTHGTPIMLAA
EKAGVTPEAFIANIQASHERDFAAFGVTFDHYDSTNSPVNRELTEAFYTKLEAAGHISRR
SVAQFYDPAKGMFLPDRYIKGICPNCGSADQYGDNCEVCGATYAPTELKEPKSVISGATP
ELRDSEHFFFEVGHFDGFLREWLDGDVALPGVKAKLKEWLDAEGGLRAWDISRDAPYFGF
QIPGQPGKYFYVWLDAPIGYLCSFKTLCAQMGEDFQAHLAAGTQTELHHFIGKDIVNFHG
LFWPAVLHGTGHRAPTRLHVNGYLMVDGAKMSKSRGTFVMARTFLDVGLEPEALRYYFAA
KSSGGVDDLDLNLGDFVARVNADLVGKFVNLASRCAGFIGKRFDGKLADALPDPAQYARF
VEALAPIREAYERNDPASAIRQTMALADEANKYIDDTKPWVIAKQEGADAQLQSVCTQGL
NLFRLLVAALKPILPRTAAEAEAFLSAPMTSWEDVSRPLTCHVIQPYTALFTRIDPKLID
AMTDASKDTMAAPAAPAATTKPAPSKADAAPAAVANPQSPTANPGFIGMDDFAKLDLRIG
KVLVCEAVEGSDKLLRFELDAGELGKRQIFSGIRASYGEPETLVGRSVVFIANLAPRKMR
FGISEGMILSAGFDGGTLALLDADAGAQPGMPVR
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcaccgcactcgtcactaccgccctgccctatgccaatgggccgctgcatctt
ggccatctggtcggttatatccaggccgacatctgggtgcgcgcgcgccggttgcgcggc
gacaagacctggttcgtctgcgccgatgacacccatggcacgccgatcatgcttgcggcc
gaaaaggcgggcgtcacgccagaggccttcatcgccaacatccaggccagccatgagcgc
gatttcgccgcgttcggggtgaccttcgatcactacgattcgaccaattcgccggtcaat
cgcgaactcaccgaagccttctacaccaagctcgaggccgccggccatatcagccgccgc
tcggtggcgcagttctacgatccggccaagggcatgttcctgccggaccgctacatcaag
ggcatctgtcccaactgcggcagcgccgaccagtacggcgacaactgcgaagtctgtggc
gcgacctatgcgccgaccgagctgaaagagcccaagtcggtgatctccggcgccacgccc
gagctgcgcgattcggagcactttttcttcgaagtcggccatttcgacggcttcctgcgg
gagtggctggatggcgacgtggcattgccgggcgtcaaggccaagctcaaggaatggctg
gatgccgaaggcggcctgcgcgcgtgggacatctcgcgcgacgcgccgtatttcggtttc
cagattcccggccagcccggcaagtatttctacgtctggctggacgcgccgatcggctac
ctgtgcagcttcaagaccctgtgcgcgcagatgggcgaagacttccaggcgcatctggcg
gccggcacgcagaccgaactgcaccacttcatcggcaaggacatcgtcaatttccacggc
ctgttctggccggcggtgctgcatggcaccggccaccgcgcgccaacccggctgcacgtc
aacggctacctgatggtggacggcgccaagatgtccaagtcgcgcggcaccttcgtgatg
gcgcggacgttcctggatgtcggcctggagccggaggcgctgcgctattacttcgcggct
aaatcctccggtggcgtcgacgacctggacctcaacctgggcgatttcgttgcgcgggtg
aacgcggatctggtcggcaaattcgtcaacctggccagccgctgcgccggcttcatcggc
aagcgcttcgacggcaagctggctgacgcgctgcccgatccggcgcagtacgcgcgcttt
gtcgaggcactggcgccgattcgcgaagcctacgagcgcaacgacccggccagtgcaatc
cgccagaccatggcgctggccgacgaggccaacaagtacatcgacgacaccaagccgtgg
gtgatcgccaagcaggaaggcgccgacgcgcaactgcaatcggtgtgcacgcagggcctg
aacctgttccgcctgctggtggccgcgctcaagccgatcctgccgcgtaccgccgccgag
gccgaggccttcctgtcggcaccgatgaccagttgggaggacgtgagccgcccgctcact
tgccatgtcatccagccctacaccgccctgttcacccgcattgaccccaaattgatcgac
gccatgaccgacgcttccaaagacacgatggccgcacctgcggcaccggctgcgaccacc
aagcccgcaccgagcaaggccgacgcagcgcccgccgccgttgccaatccccaatcccca
accgccaatcccggcttcatcggcatggacgatttcgccaagctcgatctgcgcatcggc
aaggtgctggtgtgcgaagcggtggaaggctccgacaagctgctgcgcttcgaactggat
gccggcgagctgggcaagcgccagatcttctcgggcatccgcgccagctacggcgagccg
gaaacgctggtcggccgcagcgtggtgttcatcgccaacctggccccgcgcaagatgcgc
ttcggcatcagcgaaggcatgatcctctcggccggcttcgacggcggcacactggcgctg
ctggacgccgacgcgggcgcacagccggggatgccggtacggtga

DBGET integrated database retrieval system