KEGG   Xanthomonas campestris pv. campestris B100: xcc-b100_3394
Entry
xcc-b100_3394     CDS       T00759                                 

Gene name
lpxH
Definition
(GenBank) UDP-2,3-diacylglucosamine hydrolase
  KO
K03269  UDP-2,3-diacylglucosamine hydrolase [EC:3.6.1.54]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
xca00540  Lipopolysaccharide biosynthesis
xca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xca00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    xcc-b100_3394 (lpxH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:xca01005]
    xcc-b100_3394 (lpxH)
Enzymes [BR:xca01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.54  UDP-2,3-diacylglucosamine diphosphatase
     xcc-b100_3394 (lpxH)
Lipopolysaccharide biosynthesis proteins [BR:xca01005]
 Lipid A
  xcc-b100_3394 (lpxH)
SSDB
Motif
Pfam: Metallophos Metallophos_2 SseB
Other DBs
NCBI-ProteinID: CAP52759
UniProt: B0RU17
Position
3866368..3867111
AA seq 247 aa
MTTLFISDLHLDPARPAITELFLDFLRTQVPGSDALYILGDLFEAWIGDDTPSTAADAVA
EALHAVATTGVPVFFMPGNRDFLVGAAYAQRAGFRILPDPTVIDLYGQPTLLMHGDLLCT
DDTAYQAFRAQTRDPAFQAQFLSQPLAARVAFAQQARAASHARQSELKQGDQAQFETVTD
VAPAEVDATFVRYGLDRIIHGHTHRPAIHIVQAGGRTCTRVVLGDWYEQGSVLRVDADGL
ALEQLAL
NT seq 744 nt   +upstreamnt  +downstreamnt
atgacgaccctgttcatctccgacctgcatctggacccggcccggccggcgatcaccgag
ctgttcctggatttcctgcgcacgcaggtacccggcagcgacgcgctctacatccttggc
gatctgttcgaggcgtggatcggcgacgacaccccgtcgaccgccgcggatgcggtggcc
gaggccttgcacgcggtggccaccaccggtgtgccggtgttcttcatgcccggcaatcgc
gacttcctggtcggtgccgcctacgcgcaacgcgccggcttccgcatcctgcccgacccc
accgtcatcgatctgtacgggcagccgacgctactgatgcacggcgacctgctgtgcacc
gacgacaccgcctaccaggccttccgcgcgcaaacgcgcgacccggctttccaggcacag
ttcctgtcgcagccgctggccgcacgcgtggcgttcgcacagcaggcacgcgccgcgagc
catgcgcgccagtcagagctcaagcaaggcgaccaggcacagttcgaaaccgtgaccgac
gtggcgccggccgaggtggatgccaccttcgtgcgctacggcctggaccgcatcatccac
ggccacacccaccgcccggccatccacatcgtgcaggccggtggccgcacctgcacacgc
gtggtgctgggcgattggtacgaacaaggctcggtgttgcgcgtggacgccgacggcctg
gcgctggaacagctggcgctgtga

DBGET integrated database retrieval system