KEGG   Xanthomonas campestris pv. campestris B100: xcc-b100_3430Help
Entry
xcc-b100_3430     CDS       T00759                                 

Definition
(GenBank) Putative secreted peptide amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
xca00330  Arginine and proline metabolism
xca00360  Phenylalanine metabolism
xca00380  Tryptophan metabolism
xca00627  Aminobenzoate degradation
xca00643  Styrene degradation
xca01100  Metabolic pathways
xca01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xca00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    xcc-b100_3430
   00360 Phenylalanine metabolism
    xcc-b100_3430
   00380 Tryptophan metabolism
    xcc-b100_3430
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    xcc-b100_3430
   00643 Styrene degradation
    xcc-b100_3430
Enzymes [BR:xca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     xcc-b100_3430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CAP52795
UniProt: B0RU53
Position
3905925..3907553
Genome map
AA seq 542 aa AA seqDB search
MRTPILSLLSLAALSGCAVAADKPVVADAAVPPAPVEVVEADIATLQARMQAGQSSCVQL
THAYLQRIARIDRAGPSLNAVIELNPQAEADAAALDAERRAGQVRGPLHGIPLLLKDNID
ALPMVNSAGSLALASFRPTQDAFLVQRLRAAGAVILGKTNLSEWANFRSTQSSSGWSGRG
GLTRNPYALDRNPCGSSAGTGAAIAGSLATAGIGTETDGSITCPAAVNGLVGLKPTVGLV
SRDGIIPISASQDTAGPMTRTVADAAAVLQAIAAPDPQDPATRTAPPSTPNYLAHLKPDG
LRGARLGLLRNPLREDPAIAAALDRAVQTLRAAGATVIETRLATDGQWDAAEQTVLLVEF
KAGLNAYLRSHAAPVKDLDALVAFNRANAQREMPYFGQELFEQAQAAPGLEDPAYLSARA
SARRLAGEQGIDAALKADRLDALIVPTTGPAWVTTLGKGDTFPGAGYGAAAVAGYPSLSV
PMGQTQGLPLGLLFMGAAWSEPRLIELGYAYEQRSHARFAPGYAPSAPPAATPGPSQPKT
AD
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacacccatcctgtccctgctttccctggccgcgttgagcggctgcgctgttgct
gccgacaagcccgttgtcgccgacgcggccgtgccgcctgcgcctgtcgaggtggtcgaa
gccgatattgcgactctgcaggcgcgcatgcaggccggccagtccagctgcgtccaactc
acgcacgcctacctgcagcgcatcgcccgcatcgaccgcgccggaccaagcctaaatgca
gtgatcgaactgaacccgcaggccgaagccgacgccgccgcgctggatgccgaacgtcgt
gctggccaggtgcgcggcccgctgcacggcatcccgctcctgctcaaggacaacatcgac
gcgctgccgatggtcaacagcgccgggtcgctggcgttggccagcttccgtcccacacag
gatgcgttcctggtgcagcgcctgcgcgcggcgggcgcggtgatcctgggcaagaccaat
ctcagcgaatgggccaattttcgctctacccaatccagttcgggctggagcggccgcggt
gggctgactcgtaatccgtacgcgctggaccgcaacccatgcggctccagcgccggcacc
ggcgcggcgattgccggcagcctggccacggcaggcatcggcaccgagaccgatggcagc
atcacctgcccggctgcagtcaatggcctggtcgggctcaagcccacggtgggcctggtc
agccgtgacggcatcattcccatctcggccagccaggacactgccgggccgatgacgcgc
accgttgccgatgcggccgcggtactgcaggcgattgccgcgcccgatccgcaagacccg
gccacgcgcactgcgccgccgtccacaccgaactatctcgcccacctcaaacccgatggc
ctgcgcggcgcgcgcctgggcctgttgcgcaatccactgcgcgaggatcccgcgatcgcc
gccgcgttggatcgcgccgtacagaccctgcgcgcggcaggcgccacggtgatcgaaacc
cgcctggccaccgatggacagtgggatgccgctgagcagacggtcctgttggtcgaattt
aaggccggcttgaatgcctacctgcgcagccacgccgcgccggtcaaagacctggatgcg
ctggttgccttcaatcgcgccaatgcgcagcgcgaaatgccctacttcggccaggagttg
ttcgagcaggcgcaggctgcgccgggcctggaggacccggcttatctgagcgcgcgcgcc
agcgccagacggctcgccggcgaacaaggcatcgacgccgcactgaaggccgaccgcctg
gacgcgctgatcgtcccgaccaccggccctgcctgggttaccacgctcggcaagggcgac
acgtttcccggtgccggctacggcgccgcggcagtggccggatatcccagcctgagtgtg
ccgatggggcaaacccagggcttgccgctcggattgctgttcatgggcgccgcgtggagc
gagccgcgcctgatcgaactgggctacgcctacgagcaacgcagccatgcgcggtttgcg
cccggctacgcgccaagcgcaccgccggcggcgacaccgggcccatcgcaaccgaagacg
gccgactga

DBGET integrated database retrieval system