KEGG   Xanthomonas campestris pv. campestris B100: xcc-b100_3563Help
Entry
xcc-b100_3563     CDS       T00759                                 

Definition
(GenBank) Dihydrofolate reductase, probable
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
xca00670  One carbon pool by folate
xca00790  Folate biosynthesis
xca01100  Metabolic pathways
Module
xca_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xca00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    xcc-b100_3563
   00670 One carbon pool by folate
    xcc-b100_3563
Enzymes [BR:xca01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     xcc-b100_3563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: CAP52928
UniProt: B0RUI6
Position
complement(4034703..4035197)
Genome map
AA seq 164 aa AA seqDB search
MKLSLIVAFDRNHAIGRDNDLPWKLPDDLKRFKALTLGKPILMGRKTAQSLGRALPGRLN
LVLTRSGQVPFEGMHAVVSVDEAIERAAQEGAQELCVIGGGEVYLLTMERADLLAVTEVD
TAVEGADTHFPPIDPAVWVPAERSAHAADARHAFAFSFVDYQRR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctcgctcatcgtcgccttcgaccgcaaccacgccatcggccgcgacaacgat
ctgccgtggaagctgcccgatgacctgaagcgcttcaaggcgctgacactgggtaagccg
atcctgatggggcgcaagaccgcgcagtcactgggccgtgcgctgccagggcgcctgaat
ctggtgctgacgcgctcggggcaggtgcctttcgagggcatgcatgcagtggtttcggta
gacgaggcgatcgaacgcgcggcgcaggaaggtgcgcaggagctgtgcgtgatcggggga
ggcgaggtgtacctcctgaccatggagcgcgccgatctgctggcggttaccgaagtggac
acggccgtcgagggcgccgatacgcacttccctccgatcgacccggcggtgtgggtgccc
gcagagcgcagcgcgcatgcggcagacgcgcggcacgccttcgctttcagtttcgtggat
taccagcgccgctga

DBGET integrated database retrieval system