KEGG   Xanthomonas campestris pv. campestris B100: xcc-b100_4237Help
Entry
xcc-b100_4237     CDS       T00759                                 

Definition
(GenBank) Methyltransferase GidB
  KO
K03501  16S rRNA (guanine527-N7)-methyltransferase [EC:2.1.1.170]
Organism
xca  Xanthomonas campestris pv. campestris B100
Brite
KEGG Orthology (KO) [BR:xca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:xca03009]
    xcc-b100_4237
   03036 Chromosome and associated proteins [BR:xca03036]
    xcc-b100_4237
Enzymes [BR:xca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.170  16S rRNA (guanine527-N7)-methyltransferase
     xcc-b100_4237
Ribosome biogenesis [BR:xca03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    xcc-b100_4237
Chromosome and associated proteins [BR:xca03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    xcc-b100_4237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GidB MTS Methyltransf_25 Cons_hypoth95
Motif
Other DBs
NCBI-ProteinID: CAP53606
UniProt: B0RYS0
Position
complement(4786018..4786962)
Genome map
AA seq 314 aa AA seqDB search
MSVQWQRQCCRCRRRLARVIECGWWIRGVPPRRMIPPTAMRMSRCSGGYRGDCRSCDIAE
PGRSVPGKLKYDGFLPTRPRAAHRHQARHPRTCTPPSCDNRGMNDAALPPDVSAALANGL
QAQSLDADFAAPLLRYLTLLVRWNKTYNLTAVRDPREMVTRHLLDSLAMQPYIVSGTLAD
LGTGPGLPGIPLAITRPQLQVTLVESNGKKARFMREALRHLALGNARVAEARAEAVDEPA
AYDHLTARALDTLAGIIAVGGHLLRPGGSLLAMKGVYPREEIAALPAGWRVGDVHPLQVP
GLEGERHLVVVHKD
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttcaatggcagcggcagtgctgtcgctgccggcgcaggcttgcgcgcgtcatc
gagtgcggatggtggatacggggcgtgccaccgcggcggatgatcccgcccacagcgatg
cgcatgagccggtgcagcggcggctatcgtggtgattgcaggtcctgcgatatcgccgag
cctggacgttccgtgccgggcaagctcaagtacgacggcttcctgcccacgcgcccacgt
gccgcgcatcgccaccaagcgcggcacccacgcacctgcacgccacccagctgcgataat
cgcggcatgaacgatgctgcgcttccccccgatgtctccgccgcactggccaacggcctg
caggcccaatccctggatgcggactttgccgcgccgctgctgcgttacctgacgctgctg
gtgcgctggaacaagacctacaacctcaccgccgtgcgcgacccgcgcgagatggtcacc
cgccatctgctcgattcgctggccatgcagccctacatcgtcagcggcacgctggccgat
ctgggcaccggccccgggctgcccggcatcccgctggcgatcacccgcccgcagctgcag
gtgacgctggtggaaagcaacggcaagaaggcgcgtttcatgcgcgaggcgctgcggcac
ctggcgttgggcaatgcccgcgtggccgaggcgcgtgccgaagccgtggacgaaccggcc
gcctacgaccatctcaccgcccgcgcgctggatacgctggccggcatcatcgccgtcggc
gggcatctgctgcgccccggcggcagcctgctggcgatgaagggcgtctacccgcgcgag
gaaatcgccgcattgcccgccggctggcgcgtgggcgatgtgcatccgctgcaggtgccc
ggcctggagggcgagcgccacctggtggtggtgcacaaggactga

DBGET integrated database retrieval system