KEGG   Xanthomonas campestris pv. campestris 8004: XC_0204Help
Entry
XC_0204           CDS       T00247                                 

Definition
(GenBank) acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00071  Fatty acid degradation
xcb00072  Synthesis and degradation of ketone bodies
xcb00280  Valine, leucine and isoleucine degradation
xcb00310  Lysine degradation
xcb00362  Benzoate degradation
xcb00380  Tryptophan metabolism
xcb00620  Pyruvate metabolism
xcb00630  Glyoxylate and dicarboxylate metabolism
xcb00640  Propanoate metabolism
xcb00650  Butanoate metabolism
xcb00900  Terpenoid backbone biosynthesis
xcb01100  Metabolic pathways
xcb01110  Biosynthesis of secondary metabolites
xcb01120  Microbial metabolism in diverse environments
xcb01130  Biosynthesis of antibiotics
xcb01200  Carbon metabolism
xcb01212  Fatty acid metabolism
xcb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    XC_0204
   00630 Glyoxylate and dicarboxylate metabolism
    XC_0204
   00640 Propanoate metabolism
    XC_0204
   00650 Butanoate metabolism
    XC_0204
  Lipid metabolism
   00071 Fatty acid degradation
    XC_0204
   00072 Synthesis and degradation of ketone bodies
    XC_0204
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XC_0204
   00310 Lysine degradation
    XC_0204
   00380 Tryptophan metabolism
    XC_0204
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XC_0204
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XC_0204
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XC_0204
Enzymes [BR:xcb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     XC_0204
Exosome [BR:xcb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XC_0204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AAY47291
UniProt: A0A0H2X472
Position
252954..254249
Genome map
AA seq 431 aa AA seqDB search
MQGQPMPAARPVAILGGVRIPFCRQNTAYADVGNLGMSVRTLGALVERFGLHGQQLGEVA
MGAVIKHSSDWNLAREAALSSGLSPLTPGITLQRACGTSLDSVITIANKIALGQIDSGIG
GGSDTTSEVPIVYGKKLRARLLAANRAKATGDKLKALLRGFKLGELKPEFPGVAEPRTGK
SMGEHCEDMAKEWNISRDSQDEWAVASHHKLAAAYERGFFDSLIAPFRGVSRDNILRADT
SLEKLATLRPAFDKTSGRGTLTAANSTPLTDGAAAVLLSSEAWALAHGHTPMAYLRDAQV
SAVDFVHGEGLLMAPTVAVPQMLARHGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCR
NRLGLDAPLGRIDPDKINPLGSSLATGHPFAATGARVVATAAKQLEERGGGRALISICTA
GGMGVVAIVER
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggtcagccgatgcccgcagcccgtcccgtcgccatcctgggcggcgttcgtatc
ccgttctgtcgccagaacaccgcatacgcggacgtgggcaacctgggcatgtcggtgcgc
accctgggcgcgctggtcgaacgcttcgggctgcatggccagcaactgggcgaggtggcg
atgggggcggtgatcaagcattcctccgactggaacctggcccgcgaagccgcgctgtcg
tcgggcctgtcgccgctcacgccgggcatcaccctgcagcgcgcctgtggcaccagcctg
gactcggtgatcaccatcgccaacaagatcgcgctggggcagatcgactcgggcatcggc
ggcggctcggacaccacctccgaggtgccgatcgtctacggcaagaagctgcgggcgcgc
ctgctggccgccaaccgcgccaaggccaccggcgacaagctcaaggcgctgctgcgcggt
ttcaagctgggcgagctcaagcccgagttccccggcgtggccgagccgcgcaccggcaag
agcatgggcgaacactgcgaagacatggccaaggaatggaacatctcgcgtgattcgcag
gacgaatgggcagtggcttcgcaccacaagttggccgccgcgtatgagcgcgggtttttc
gattcgctgattgccccgttccgtggcgtgtcgcgcgacaacatcctgcgcgccgacacc
tcgctggaaaagctggccacgttgcgcccggcgttcgacaagacctccggccgcggcacg
ctcaccgccgccaattccaccccgctcaccgatggcgccgccgcggtgctgttgtccagc
gaagcctgggcgctggcccacggccacacgccgatggcctacctgcgcgatgcacaggtc
tcggcggtggatttcgtgcatggcgagggcctgctgatggcgcctacggttgcagtgccg
cagatgctggcgcggcacgggctgaccttgcaggacttcgacatctacgagatccacgaa
gccttcgccgcgcaggtgctgtgcacgctgcgcgcctgggagagcgaggattactgccgc
aatcgcctgggactggacgcgccgctgggccgcatcgacccggacaagatcaacccgctg
ggctcctcgctggccaccggccacccgtttgccgcgaccggcgcacgcgtcgtggctacc
gcagccaagcagctggaagaacgcggcggcggacgtgccctgatttcgatctgcaccgcc
ggcggcatgggcgtggtggcgatcgtggaacgctga

DBGET integrated database retrieval system