KEGG   Xanthomonas campestris pv. campestris 8004: XC_0224Help
Entry
XC_0224           CDS       T00247                                 

Definition
(GenBank) methyltransferase
  KO
K07316  adenine-specific DNA-methyltransferase [EC:2.1.1.72]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:xcb02048]
    XC_0224
Enzymes [BR:xcb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     XC_0224
Prokaryotic defense system [BR:xcb02048]
 Restriction and modification system (R-M system)
  Type III R-M system
   XC_0224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: N6_N4_Mtase MethyltransfD12 Met_10 Cons_hypoth95
Motif
Other DBs
NCBI-ProteinID: AAY47311
UniProt: A0A0H2X2L5
Position
270167..271798
Genome map
AA seq 543 aa AA seqDB search
MTNKYDHLDRQTLIGLLQRRDAERQLGLVWERDEIEADQALNDDFVALSLDAGLSHGEAP
WDNLIIEGDNYDALRALRMTHKGAIRCIYIDPPYNTGNKDFVYNDRFVDKTHRFRHSLWL
EFMYRRLQLAKELLADDGVIFVSIDDNEVFRLGMLMDRVFGENNFIANVIWQKVFSPKGT
AQHFSDDHEYVIIYGRDKNKWRPNLLARTAAQDRAYKNPDDDPRGLWTSGDLSARNYYSK
GVYSIVGPTGRVIAGPPAGTYWRFSEERFKELDADNRIWWGKSGDNMPRLKRFLADVQQG
TVPQTLWTYGEVGHTQDAKKQLLEVLNFNSTNDVFSTPKPIQLMERILSIASKPGDTVLD
FFAGSGTFAQAVAKLNAEDGGNRKFILVSSTEATEDTPDKNLCRDVCAERVRRVLGGYTN
AKGQPVEGLGGGFAYLRTRRIPKHRLALKLDHAEVWHALQLLHQRPLSFWPGGGFASDGE
LAYLADFQAAHVEQLREWLRTRTSAVAAVYTWSTERLNGLLGEPAADLSLLPLPHHLRER
FGR
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacaaatacgatcatctcgaccgtcaaaccttgatcggtctactgcagcggcgc
gatgccgagcggcagctgggtttggtatgggagcgcgacgagatcgaggccgaccaggca
ctcaacgacgattttgtcgcgttgtcattggacgctggtttaagccatggtgaggcaccg
tgggacaacctgatcatcgaaggcgacaactacgacgcgctgcgtgcgctgcggatgact
cacaaaggcgcgatccgctgcatttatatcgacccgccttacaacaccggtaataaggac
ttcgtctacaacgaccgtttcgtcgacaagactcaccggttccgtcattcgctgtggctg
gagttcatgtatcggcgcctgcagctggctaaagagttgttggctgatgatggagttatt
tttgtcagtattgatgacaatgaggtgtttcgacttggaatgttgatggaccgtgtattt
ggagagaataattttattgccaatgttatttggcaaaaagtcttttccccaaaagggaca
gcacaacatttctctgacgatcacgagtatgtgattatttacgggcgtgacaaaaataaa
tggcgacctaacttgcttgcaagaacggctgctcaagatcgcgcctataaaaatcctgat
gatgatccccgcggcctttggacttcgggagatctttcagctagaaattactattccaag
ggagtctattcgattgtcggcccaactggccgagtcatcgcaggcccgcctgcaggaacg
tattggcgtttctccgaagaaagatttaaagagctggatgcggacaatcgtatttggtgg
ggcaaaagtggcgataatatgcctcgactcaagcggtttctagcagatgtccagcaaggc
acggttccacaaacactttggacttacggcgaagtcggtcacacgcaagatgcaaagaag
cagctacttgaagtcctcaattttaattctacaaatgatgttttctctacccctaagccc
atccaattgatggagcgaatactaagcatcgccagcaagccgggtgacactgtccttgat
ttctttgcaggctcgggaacgtttgctcaggcagttgccaaactaaatgctgaagatggc
ggcaatcgtaagttcatcctggtcagcagcaccgaagccaccgaggatacgcctgacaag
aacctctgccgcgatgtttgcgccgagcgcgtgcgtcgtgtgttgggtggctacaccaat
gccaaggggcaaccggttgagggcctgggtggcggcttcgcctacttgcgtacccgtcgt
attccgaagcatcggttggcgctcaagctggaccacgcggaggtttggcatgcgctgcag
ctattgcatcagcggccgttgtcgttctggcctggcggcggttttgccagtgatggcgaa
ctggcctatctggcggatttccaggccgcacatgtagaacagttacgtgagtggctgcgg
acccgcacatcggcagtcgctgccgtctatacctggtcgacggaacggctgaacggattg
ctgggagagccagcggccgacttgtctttgttgcccttgccgcaccacctgcgcgaacgc
ttcggacgttga

DBGET integrated database retrieval system