KEGG   Xanthomonas campestris pv. campestris 8004: XC_0227Help
Entry
XC_0227           CDS       T00247                                 

Definition
(GenBank) ferredoxin
  KO
K06940  uncharacterized protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    XC_0227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CxxCxxCC
Motif
Other DBs
NCBI-ProteinID: AAY47314
UniProt: A0A0H2X344
Position
complement(275327..275710)
Genome map
AA seq 127 aa AA seqDB search
MAHPCLTCGACCAYFRVSFHWSEADPALGGRVPIALTDALRTHERVMRGTSQAQPRCIAL
DADIGRYSRCSIHDRRPSSCAAVPASLEFGERSTQCDKSRLAHGLHALTEADWVGVDDAQ
RNPLPTL
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggcacacccctgccttacctgcggcgcctgctgcgcctacttccgcgtcagtttccac
tggagcgaagccgatcccgcgctgggcggcagggtaccgattgcgttgacggatgcactg
cgtacgcacgaacgggtgatgcgtggcacctcgcaagcgcagccacgctgcattgcgctg
gacgcagacatcggccgctacagccgttgcagcatccacgaccgccgcccgtcatcgtgt
gccgcggtgccggcatcgctggagttcggcgagcgcagcacgcaatgcgacaagtcgcgg
ctggcacatggcctgcacgcgctcactgaagccgactgggttggcgtggacgacgcgcaa
cgcaacccgctgcctacgctgtaa

DBGET integrated database retrieval system