KEGG   Xanthomonas campestris pv. campestris 8004: XC_0229Help
Entry
XC_0229           CDS       T00247                                 

Definition
(GenBank) NAD(P)H steroid dehydrogenase
  KO
K22320  2-alkyl-3-oxoalkanoate reductase [EC:1.1.1.412]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    XC_0229
Enzymes [BR:xcb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.412  2-alkyl-3-oxoalkanoate reductase
     XC_0229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3Beta_HSD Epimerase NAD_binding_10 NAD_binding_4 GDP_Man_Dehyd RmlD_sub_bind Polysacc_synt_2 NmrA adh_short
Motif
Other DBs
NCBI-ProteinID: AAY47316
UniProt: A0A0H2X2L7
Position
277811..278824
Genome map
AA seq 337 aa AA seqDB search
MMKILVTGGGGFLGQALCRGLVARGHEVVSFQRGDYPVLHTLGVGQIRGDLADPQAVRHA
LAGIDAVFHNAAKAGAWGSYDSYHQANVVGTQNVLDACRANGVPRLIYTSTPSVTHRATN
PVEGLGADEVPYGEDLRAPYAATKAIAERAVLAANDAQLATVALRPRLIWGPGDNHLLPR
LAARARAGRLRMVGDGSNLVDSTYIDNAAQAHFDAFAHLAPGAACAGKAYFISNGEPLPM
RELLNRLLAAVDAPAVTRSLSFKTAYRIGAVCETLWPLLRLPGEVPLTRFLVEQLCTPHW
YSMEPARRDFGYVPQISIEEGLQRLRSSSSRDISITR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaagattctggtaacgggtggtggcggctttctcgggcaggcgctgtgccgtgga
ttggtggcgcgtggacacgaggtggtgagctttcagcgtggtgactatccggtgctgcac
accttgggtgtgggccagatccgtggcgatctggctgacccgcaggcggtgcggcatgcg
cttgccggcatcgatgcggtgttccacaacgcggccaaggccggggcgtggggcagctac
gacagctatcaccaggccaacgtggtgggcacgcagaacgtgctcgatgcatgccgtgcc
aatggcgtaccgcgcttgatctacacctccacgcccagcgtgacccatcgcgccaccaat
ccggtggaaggcttgggcgcggacgaagtgccgtatggcgaagacctgcgcgcgccgtat
gcggcgaccaaggcaattgccgaacgcgcggtgctggcagccaacgatgcacagctggcc
accgttgcgttgcgcccgcgcttgatctgggggccgggcgacaaccacctgctgccgcgt
ctggcggcacgtgcgcgcgccgggcggctgcggatggtgggcgatggcagcaacctggtg
gacagcacctacatcgacaatgcggcgcaggcgcacttcgatgcgttcgcgcatctggcg
ccgggcgctgcgtgcgcaggcaaggcgtacttcatctccaacggcgaaccgttgccgatg
cgcgagctactcaaccgtttgctggcggcggtggatgcaccagcggtgacgcgctcgctg
tcgttcaagacggcgtaccgcatcggtgcggtgtgcgaaacattgtggccactgttgcgt
ctgccaggcgaagtgccgctgacgcggtttctggtcgagcagctatgcacgccgcattgg
tacagcatggaaccggcgcggcgtgactttggctatgtgccgcagatcagcatcgaagag
ggcctgcaacggctgcgatcctcatcttcccgcgacatctccatcactcgataa

DBGET integrated database retrieval system