KEGG   Xanthomonas campestris pv. campestris 8004: XC_0240Help
Entry
XC_0240           CDS       T00247                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01284  peptidyl-dipeptidase Dcp [EC:3.4.15.5]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
Enzymes [BR:xcb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.5  peptidyl-dipeptidase Dcp
     XC_0240
Peptidases [BR:xcb01002]
 Metallo Peptidases
  Family M3
   XC_0240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M3 DUF1932 Peptidase_M50B
Motif
Other DBs
NCBI-ProteinID: AAY47327
UniProt: A0A0H2X478
Position
288000..290078
Genome map
AA seq 692 aa AA seqDB search
MPEKTATTQTPDAAPNPLLTASTLPFQAPPFDKIQDSDYLPAFEEGMRQHLADVRKIADN
PEPANFDNTIEAMERSGETLTRVSRIFFGLVQADTSDARQKIQEEVAPKLAAHQDEINLD
PKLFARVKAIYDQRDTLSLEPEQKRLVERHYEELVRAGAQLSDADKTTLRKLNVEETTLS
TQFHTKLVAASAAAAVVVDDKAKLDGLSEGDIAAAADAAKARKLDGKYLLTLQNTTQQPV
LASLKDHDLRAQVMKASQTRAEQGDANDTRQTIQRLAQLRAQKAKLLGFDSYAAYSLGDQ
MAKTPEAALKLLTDTVPAATAKARREVGEMQKVIDAQQGGFKLAAADWDFYAEQVRKAKY
DLDESQIKPYFELDNVLQNGVFYAATQLYGITFKQRTDIPTYHADMKVYEVFDADGTSMA
LFYTDYFKRDSKSGGAWMDVFVEQDGLTGTKPVVYNVCNFTKPAAGQPALLSFDDVTTLF
HEFGHALHGMFSKVKYPSIAGTSTSRDFVEFPSQFNEHWASDPKVFANYAKHYQTGAAMP
DALVEKIKKAKTFNSGYATTEYLSAALLDLAWHTQPADAPLQDVSKFEVDALKRFKVDLA
EVPPRYRSTYFDHIWGGGYSAGYYAYFWSEVLDDDAFEWFKENGGLTRKNGDTFRAKILS
RGNTVDLATLYRDFRGKDPSVKALLENRGLTE
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgagaagaccgctaccacccagaccccggatgccgcgccgaacccgctgctgacc
gccagcacgctgccgttccaggcgccgccgttcgacaagatccaggacagcgattacctg
cctgcgttcgaagaaggcatgcgccagcatctggcggacgtgcgcaagattgccgacaac
cccgagccggccaacttcgacaacaccatcgaggcgatggagcgcagcggcgaaacgctc
acccgcgtctcgcgcattttctttggcctggtgcaggccgataccagcgacgcccgccag
aaaatccaggaagaggtggcgcccaagttggccgcgcaccaggacgagatcaatctggat
cccaagctgttcgcacgcgtcaaggcgatctacgaccaacgcgacacgctcagcctggag
ccggagcaaaagcgcctggtcgaacgccattacgaagagctggtgcgcgccggtgcgcag
ctgtccgacgccgacaagaccaccttgcgcaagctcaacgtggaggagaccacgctctcc
acgcagttccataccaagctggtggctgcctcggctgctgccgccgtggtggtcgacgac
aaggccaagctcgatggcttgagcgagggcgacatcgccgccgccgccgatgccgccaag
gcgcgcaagctcgatggcaagtatctgctgaccctgcagaacaccacccagcagccggtg
ctggcttcgctgaaggaccatgacctgcgcgcgcaggtgatgaaagcctcgcaaacccgt
gccgaacagggcgacgccaacgacacccgccagaccatccagcggctggcgcagctgcgc
gcgcaaaaagccaagctgctcggcttcgacagctacgccgcctacagcctgggcgaccag
atggccaagacgccggaggccgcgctcaagctgttgaccgacaccgtgccggcggcgacc
gccaaggcgcgccgcgaagtgggcgagatgcagaaggtcatcgatgcgcagcagggcggc
ttcaagctcgctgcggcggattgggacttctacgccgagcaggtgcgcaaggccaagtac
gacctggacgaatcgcagatcaagccgtatttcgaactggacaacgtgctgcagaacggc
gttttctacgcggccacgcagctgtatggcatcaccttcaagcagcgcaccgacatcccg
acctatcacgcggacatgaaggtgtacgaagtgttcgatgcggacggcacctcgatggcg
ctgttctacaccgactacttcaagcgcgacagcaagtccggtggcgcctggatggatgtg
ttcgtggagcaggacgggctgaccggcaccaagccggtggtctacaacgtgtgcaacttc
accaagcccgccgcgggccagccggcgctgctgagctttgatgacgtcaccaccttgttc
catgagttcggtcacgcactgcatggcatgttctccaaggtgaagtacccctcgatcgcc
ggcaccagcacctcgcgtgactttgtcgagttcccctcgcagttcaacgagcactgggcg
tccgacccgaaggtcttcgccaactacgccaagcactaccagaccggtgcagcgatgccc
gatgccctggtggagaagatcaagaaggccaagaccttcaacagcggctacgccaccacc
gagtacttgtcggcggcattgctcgacctggcctggcacacccagccggccgatgcaccg
ctgcaggacgtgagcaagttcgaggtcgatgcgttgaagcgcttcaaggtcgatctggcc
gaagtcccgccgcgctaccgcagcacctatttcgaccacatctggggcggcggttattcg
gccggctactacgcctatttctggtcggaagtgctcgatgacgacgcgttcgagtggttc
aaggaaaatggcggcctgacccgcaagaacggcgacaccttccgcgccaagatcctttcg
cgcggcaataccgtggatctggcgacgctgtaccgcgatttccgtggcaaggatcccagc
gtcaaggcgctgttggaaaaccgtggtttgacggagtaa

DBGET integrated database retrieval system