KEGG   Xanthomonas campestris pv. campestris 8004: XC_0242Help
Entry
XC_0242           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B_2 Lactamase_B_3 Lactamase_B
Motif
Other DBs
NCBI-ProteinID: AAY47329
UniProt: A0A0H2X2V3
Position
complement(292774..293826)
Genome map
AA seq 350 aa AA seqDB search
MPPPSSAYAASPQFRNGRFRNAQPTLTTSLRLGEQLRLLWTFFFDKPRDTVPSTPPPVLP
LTRAQLLAAPDRSLYRLGHSTVLLKLAGGFWLTDPVFAKRASPFSFAGPKRFHAPPIALA
DLPPLAGVILSHNHYDHLDRATIRALADRVGVFVAPLGVGDLLVRWGVDPAKVRQLDWWD
SLNVDGVQLTATPSQHFSGRGLFDSGRSLWCSWVIQHEELRVFFSGDGGYAPHFKTIGEQ
LGPFDVALIENGAYDQQWPHVHMQPEQSLQAYLDVGGQTLLPIHNGTFDLAMHAWQEPLD
RIVALADSAGVALVTPCMGERVDLQAPANRVRWWRQDAAAAASDGMVVTR
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgccccccccttcttccgcttatgccgcttcgccgcagttccgcaatggccggtttcgc
aacgcccagcccacgctgaccacctcgctgcgcctgggcgagcagctgcggttgctgtgg
acgttcttcttcgacaagccacgcgacaccgtaccgtccacaccaccgccggtgttgccg
ctgactcgcgcgcagctgctcgccgcgccggaccgcagcctgtaccggcttggccactcc
accgtgttgctgaagctggccggcggtttctggctcaccgacccggtgttcgccaagcgc
gcctcgccgttttccttcgccggccccaaacgcttccatgccccgccgattgcactggcc
gacctgccgccgctggccggggtgatcctgtcgcacaaccactacgaccacctggaccgc
gccaccatccgcgcactggccgaccgcgttggcgttttcgtcgcgccgctgggcgtgggc
gatttactggtacgttggggcgtggacccggccaaggtgcggcagctggactggtgggac
tcgctcaacgtggacggtgtgcagctcaccgccacgccatcgcagcacttttccgggcgc
gggttgttcgatagcggccgctcgctgtggtgctcgtgggtgatccagcacgaggagctg
cgggtgttcttcagcggcgacggtggctacgcgccgcacttcaagaccatcggtgagcag
ctcggcccgttcgatgtggcgctgatcgaaaacggcgcctacgaccagcaatggccgcat
gtgcacatgcaaccggagcagagcctgcaggcatatctggacgtgggcgggcagacgctg
ctgccgatccacaacggcaccttcgatctggccatgcacgcctggcaggagccgctggac
cggatcgtggcgttggccgatagcgccggcgttgcgctggtcacgccgtgcatgggcgag
cgggtggatctgcaggcgccggccaatcgcgtgcgttggtggcggcaggatgcggcggca
gcggcgtcggatggaatggtggtgacgcggtaa

DBGET integrated database retrieval system