KEGG   Xanthomonas campestris pv. campestris 8004: XC_0243Help
Entry
XC_0243           CDS       T00247                                 

Definition
(GenBank) transcriptional regulator tetR family
  KO
K19736  TetR/AcrR family transcriptional regulator, regulator of autoinduction and epiphytic fitness
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xcb03000]
    XC_0243
Transcription factors [BR:xcb03000]
 Prokaryotic Type
  Helix-turn-helix
   TetR/AcrR family
    XC_0243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_C_7 TetR_N TetR_C_6 TetR_C_11 HTH_23 HTH_22 HTH_11 HTH_36
Motif
Other DBs
NCBI-ProteinID: AAY47330
UniProt: A0A0H2X4B8
Position
293915..294547
Genome map
AA seq 210 aa AA seqDB search
MSIHSSTFAAPQRLTDRKRHAILEAAIAEFRQQGFEATSMDRIAATAGVSKRTVYNHFPS
KDTLFGEILRGLWQRSAEAVSLAYQPGQPLRPQLLELLQQKLRLLEDPAFIDLSRVAIAE
GIHSPARARELLAQLGSKEEGTTTWVRAALADGRLVAVDPAFAAQQLQALVKGFAFWPQL
ALGQPALSPEEQAQVAASAVDMFLGVYARQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtccattcactcgtccactttcgctgcgccgcagcggctgaccgaccgcaagcgtcac
gcgatcctggaagcggcgatcgccgagttccgccagcagggcttcgaggcgaccagcatg
gaccgcatcgcggccaccgctggcgtctccaagcgcacggtttacaaccatttccccagc
aaggacacgctgttcggcgagatcctgcgcgggctatggcagcgcagtgccgaggcggtg
agcctggcgtatcagcccggccagccattgcggccgcagctgctggagttgctgcagcag
aagctgcggctgctggaagacccggccttcatcgacctctcccgcgtggcgattgccgag
ggcatccactcgccggcgcgggcacgcgaactgctcgcgcagctgggcagcaaggaggaa
ggcaccaccacctgggtgcgcgccgcgctggccgacggccggctggtggcagtggacccg
gcctttgccgcacagcaattgcaggccctggtgaagggctttgcgttctggccgcagctg
gccctgggccagccggccctgtcgccggaagaacaggcgcaggtcgcggcgtcggcggtg
gacatgttcctgggcgtgtacgcgcgtcagtga

DBGET integrated database retrieval system