KEGG   Xanthomonas campestris pv. campestris 8004: XC_0248Help
Entry
XC_0248           CDS       T00247                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00630  Glyoxylate and dicarboxylate metabolism
xcb01100  Metabolic pathways
xcb01110  Biosynthesis of secondary metabolites
xcb01120  Microbial metabolism in diverse environments
xcb01200  Carbon metabolism
Module
xcb_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    XC_0248
Enzymes [BR:xcb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     XC_0248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AAY47335
UniProt: Q4V038
Position
298811..300136
Genome map
AA seq 441 aa AA seqDB search
MPHPCPRRRTMSTPLQTAEQIQHDWATHPRWAGITRNYTAADVVRLRGTVHVEHSLARLG
ADKLWTSLHATPFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLAGQMYPDQSLY
PADSVPAVVKRINNTLLRADQLHHAEGDDAIDFLQPIVADAEAGFGGVLNAFELMKAMIE
AGAAGVHFEDQLASVKKCGHMGGKVLVPTREAIEKLNAARLAADVLGVPTVLIARTDAEA
ADLITSDVDDNDRGFTTGERTVEGFFKTRNGLDQAISRGLAYAPYADVIWCETGKPDLEF
ARAFAQAIHAKFPGKLLAYNCSPSFNWKKNLDDATIARFQTELASYGYKFQFITLAGFHA
LNYGMFHLAHGYARSQMSAFVELQQAEFAAAERGFTAVKHQREVGTGYFDAVTQAIQQGQ
SSTTALRGSTEEAQFHGEKAA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
ttgccccatccctgcccgaggagacgcacgatgagcacaccgctgcagaccgccgaacag
attcagcatgactgggccacccacccgcgctgggccggcatcacccgcaattacaccgcc
gccgatgtggtgcgcctgcgcggcaccgtgcacgtcgagcattcgctggcacggctgggc
gcggacaaactctggacatcgctgcatgccacgcccttcgtcaacgccttgggcgcgctc
accggcaaccaggcgatgcagcaggtcaaggccggcttgaaggcgatctatctctccggt
tggcaggtggcggccgacgccaatctggccgggcagatgtatccggaccaatcgctgtac
ccggccgattcggtgccggcggtggtcaagcgcatcaacaataccttgctgcgcgccgat
cagttgcaccatgccgaaggcgatgatgcgatcgacttcctgcagccgatcgtggccgat
gccgaagccggtttcggtggcgtgctcaatgccttcgaactgatgaaggcgatgatcgaa
gctggcgcagccggcgtgcatttcgaggaccagctggcctcggtgaaaaaatgcggacac
atgggtggcaaggtgttggtgccgacccgcgaagcgatcgagaaattgaatgccgcgcgg
ctggccgccgatgtgctgggcgtgcccaccgtcttgatcgcacgcaccgacgccgaagcc
gccgacctgatcaccagcgacgtggacgacaacgaccgcggtttcaccaccggcgagcgc
actgtggaaggctttttcaagacccgcaacggcctggaccaggccatcagtcgcggcctg
gcctatgcgccgtacgcggatgtgatctggtgcgaaaccggcaagccggacctggagttt
gcccgcgcctttgcgcaggccatccatgccaagttccccggcaagctgctggcctataac
tgctcgcccagcttcaactggaagaagaatctggacgacgccaccatcgccaggttccag
accgaactggccagctatggctacaagttccagttcatcaccctggccggcttccacgcg
ctgaattacggtatgttccacctcgcccacggctatgcgcgcagccagatgagtgccttt
gtcgagctgcagcaagccgagttcgcggccgcagagcgtggctttactgcggtcaagcac
cagcgcgaagtgggcaccggctacttcgatgcagtgacgcaggcgattcagcaggggcag
tcctcgaccaccgcattgcgtggctccaccgaagaagcacagtttcacggcgagaaggcg
gcttag

DBGET integrated database retrieval system